1ELK: VHS domain of TOM1 protein from H. sapiens

VHS domain of TOM1 protein from H. sapiens. Determined by X-ray diffraction at 1.5 Å resolution. Released 22 Mar 2000.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,787
Mol. weight: 34.97 kDa
Released: 22 Mar 2000

Explore 1ELK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ELK contains 21 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	8-10	3
α-helix	12-20	9
α-helix	30-42	13
α-helix	46-58	13
α-helix	64-80	17
α-helix	83-89	7
α-helix	92-94	3
α-helix	95-100	6
α-helix	101-103	3
α-helix	111-128	18
α-helix	135-147	13

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	12-20	9
α-helix	30-42	13
α-helix	46-58	13
α-helix	64-80	17
α-helix	83-89	7
α-helix	92-94	3
α-helix	95-100	6
α-helix	101-103	3
α-helix	111-128	18
α-helix	135-146	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Target of MYB1	A, B	protein	157	Homo sapiens	O60784 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1ELK_1 TARGET OF MYB1 (chains A, B)
GAMGSDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKK
RIVGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDK
VLNLIQSWADAFRSSPDLTGVVTIYEDLRRKGLEFPM

Primary citation

Structure of the VHS domain of human Tom1 (target of myb 1): insights into interactions with proteins and membranes. Misra, S., Beach, B., Hurley, J.H. Biochemistry (2000) 39:11282-11290. DOI 10.1021/bi0013546 · PubMed

Other PDB entries of the same protein (UniProt O60784 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9KZN 1.35 Å, Crystal structure of Tom1 in complex with Tollip
1WRD 1.75 Å, Crystal structure of Tom1 GAT domain in complex with ubiquitin
6J56 1.8 Å, Crystal structure of Myosin VI CBD in complex with Tom1 MBM
2N2N Tom1 negatively modulates binding of Tollip to phosphatidylinositol 3-phosphate via a…
2N9D Structure analysis of the Tom1 GAT domain reveals distinct ligand-specific…

Browse structure collections

About this viewer

MolViewer shows 1ELK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.