Tom1 negatively modulates binding of Tollip to phosphatidylinositol 3-phosphate via a coupled folding and binding mechanism. Determined by solution NMR. Released 16 Sept 2015.
Explore 2N2N in 3D Show helices and sheets RCSB PDB PDBe
2N2N contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 216-240 | 25 | |
| α-helix | 248-271 | 24 | |
| α-helix | 272-274 | 3 | |
| α-helix | 281-305 | 25 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Target of Myb protein 1 | A | protein | 100 | Homo sapiens | O60784 (AlphaFold model) |
>2N2N_1 Target of Myb protein 1 (chains A) GPLGSEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVL ELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQT
Tom1 Modulates Binding of Tollip to Phosphatidylinositol 3-Phosphate via a Coupled Folding and Binding Mechanism. Xiao, S., Brannon, M.K., Zhao, X. et al. Structure (2015) 23:1910-1920. DOI 10.1016/j.str.2015.07.017 · PubMed
Other PDB entries of the same protein (UniProt O60784 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2N2N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.