2N9D: Target of Myb protein 1

Structure analysis of the Tom1 GAT domain reveals distinct ligand-specific conformational states. Determined by solution NMR. Released 21 Sept 2016.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 774
Mol. weight: 11.5 kDa
Released: 21 Sept 2016

Explore 2N9D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N9D contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	216-240	25
α-helix	248-271	24
α-helix	278-306	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Target of Myb protein 1	A	protein	100	Homo sapiens	O60784 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2N9D_1 Target of Myb protein 1 (chains A)
GPLGSEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVL
ELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQT

Primary citation

Structure of the GAT domain of the endosomal adapter protein Tom1. Xiao, S., Ellena, J.F., Armstrong, G.S. et al. Data Brief (2016) 7:344-348. DOI 10.1016/j.dib.2016.02.042 · PubMed

Other PDB entries of the same protein (UniProt O60784 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9KZN 1.35 Å, Crystal structure of Tom1 in complex with Tollip
1ELK 1.5 Å, VHS domain of TOM1 protein from H. sapiens
1WRD 1.75 Å, Crystal structure of Tom1 GAT domain in complex with ubiquitin
6J56 1.8 Å, Crystal structure of Myosin VI CBD in complex with Tom1 MBM
2N2N Tom1 negatively modulates binding of Tollip to phosphatidylinositol 3-phosphate via a…

Browse structure collections

About this viewer

MolViewer shows 2N9D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.