1ELO: Elongation factor G without nucleotide

Name: PDB 1ELO: Elongation factor G without nucleotide
Published: 1996-08-01
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: elongation factor

Elongation factor G without nucleotide. Determined by X-ray diffraction at 2.8 Å resolution. Released 1 Aug 1996.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Thermus thermophilus
Chains: 1
Atoms: 4,957
Mol. weight: 76.98 kDa
Released: 1 Aug 1996

Explore 1ELO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ELO contains 25 α-helices and 60 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 60 β-strands

Element	Residues	Length	Sheet
β-strand	12-15	4	1
α-helix	21-24	4
α-helix	26-36	11
β-strand	70-74	5	1
β-strand	77-81	5	1
α-helix	91-99	9
β-strand	105-108	4	2
α-helix	110-112	3
α-helix	116-127	12
β-strand	133-136	4	2
α-helix	146-152	7
α-helix	153-157	5
β-strand	161	1	3
β-strand	165-167	3	4
β-strand	177-179	3	4
β-strand	184-188	5	4
β-strand	196-199	4	4
α-helix	200-202	3
α-helix	203-205	3
α-helix	206-223	18
α-helix	225-231	7
α-helix	236-238	3
α-helix	239-251	13
β-strand	256	1	3
β-strand	258-260	3	2
β-strand	262	1	5
α-helix	263-265	3
β-strand	267	1	5
α-helix	269-279	11
α-helix	281-282	2
β-strand	289	1	6
β-strand	292	1	7
β-strand	298	1	7
β-strand	301	1	6
β-strand	310-317	8	8
β-strand	325-332	8	8
β-strand	334-336	3	9
β-strand	339-342	4	10
α-helix	344-346	3
β-strand	349-352	4	10
β-strand	354-357	4	8
β-strand	364-366	3	8
β-strand	368-370	3	9
β-strand	371	1	11
β-strand	373	1	11
β-strand	374-378	5	8
β-strand	388-389	2	8
β-strand	390-391	2	10
β-strand	392	1	12
β-strand	394	1	12
α-helix	395-396	2
β-strand	398	1	7
β-strand	414	1	13
β-strand	440	1	14
β-strand	451	1	14
α-helix	458-463	6
β-strand	480	1	13
β-strand	484-486	3	15
β-strand	491-492	2	16
β-strand	497-498	2	17
β-strand	507-508	2	17
β-strand	509-514	6	16
β-strand	516	1	18
β-strand	519	1	19
β-strand	521	1	19
β-strand	524-527	4	16
α-helix	539-549	11
β-strand	560	1	15
β-strand	563	1	18
β-strand	564-571	8	16
β-strand	577	1	17
α-helix	580-584	5
α-helix	586-595	10
β-strand	600-602	3	15
β-strand	603-605	3	20
β-strand	608-612	5	21
α-helix	620-626	7
β-strand	633-636	4	21
β-strand	641-645	5	21
β-strand	648	1	20
α-helix	655-661	7
β-strand	668	1	21
β-strand	671	1	21
β-strand	675-677	3	20
α-helix	681-687	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongation factor G	A	protein	691	Thermus thermophilus	Q5SHN5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ELO_1 ELONGATION FACTOR G (chains A)
MAVKVEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERE
RGITITAAVTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSET
VWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDV
LRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEE
ELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVE
IHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHA
NHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKAD
QEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQ
VAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIP
AVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPV
ILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLR
SKTQGRGSFVMFFDHYQEVPKQVQEKLIKGQ

Primary citation

Three-dimensional structure of the ribosomal translocase: elongation factor G from Thermus thermophilus. AEvarsson, A., Brazhnikov, E., Garber, M. et al. EMBO J (1994) 13:3669-3677. PubMed

Other PDB entries of the same protein (UniProt Q5SHN5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DAR 2.4 Å, Elongation factor G in complex with GDP
2EFG 2.6 Å, Translational elongation factor G complexed with GDP
1EFG 2.7 Å, The crystal structure of elongation factor G complexed with GDP, at 2.7 Å resolution
4WPO 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQF 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQU 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQY 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4V9H 2.86 Å, Crystal structure of the ribosome bound to elongation factor G in the guanosine…
4V90 2.95 Å, Thermus thermophilus Ribosome
5HAU 3.0 Å, Crystal structure of antimicrobial peptide Bac7(1-19) bound to the Thermus thermophilus…
4V9K 3.5 Å, 70S ribosome translocation intermediate GDPNP-I containing elongation factor EFG/GDPNP,…
4V9L 3.5 Å, 70S Ribosome translocation intermediate FA-3.6A containing elongation factor EFG/FUSIDIC…

Browse structure collections

About this viewer

MolViewer shows 1ELO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.