1EMR: Human leukemia inhibitory factor

Crystal structure of human leukemia inhibitory factor (LIF). Determined by X-ray diffraction at 3.5 Å resolution. Released 21 Mar 2001.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,232
Mol. weight: 17.52 kDa
Released: 21 Mar 2001

Explore 1EMR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EMR contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	26-49	24
α-helix	57-60	4
α-helix	77-105	29
α-helix	110-135	26
α-helix	156-177	22
α-helix	178-180	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leukemia inhibitory factor	A	protein	159	Homo sapiens	P15018 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1EMR_1 LEUKEMIA INHIBITORY FACTOR (chains A)
LMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLEKLCGPNVTDFPPFHANGTEKAKLV
ELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGH
VDVTYGPDTSGKDVFQKKKLGCQLLGKYKQVISVLAQAF

Primary citation

Species Variation in Receptor Binding Site Revealed by the Medium Resolution X-ray Structure of Human Leukemia Inhibitory Factor. Robinson, R.C., Heath, J.K., Hawkins, N. et al. To be published.

Other PDB entries of the same protein (UniProt P15018 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1PVH 2.5 Å, Crystal structure of leukemia inhibitory factor in complex with gp130
7N0A 3.1 Å, Structure of Human Leukaemia Inhibitory Factor with Fab MSC1
8D6A 3.54 Å, Cryo-EM structure of human LIF signaling complex: model containing the interaction core…
2Q7N 4.0 Å, Crystal structure of Leukemia inhibitory factor in complex with LIF receptor (domains 1-5)

Browse structure collections

About this viewer

MolViewer shows 1EMR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.