Crystal structure of human parathyroid hormone 1-34 at 0.9 a resolution. Determined by X-ray diffraction at 0.9 Å resolution. Released 6 Sept 2000.
Explore 1ET1 in 3D Show helices and sheets RCSB PDB PDBe
1ET1 contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-33 | 31 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Parathyroid hormone | A, B | protein | 34 | Homo sapiens | P01270 (AlphaFold model) |
>1ET1_1 PARATHYROID HORMONE (chains A, B) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Crystal structure of human parathyroid hormone 1-34 at 0.9-A resolution. Jin, L., Briggs, S.L., Chandrasekhar, S. et al. J Biol Chem (2000) 275:27238-27244. PubMed
Other PDB entries of the same protein (UniProt P01270 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ET1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.