1EUJ: Endothelial monocyte activating polypeptide 2

Name: PDB 1EUJ: A novel anti-tumor cytokine contains a RNA-binding motif present in aminoacyl-tRNA synthetases
Published: 2000-09-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cytokine

A novel anti-tumor cytokine contains a RNA-binding motif present in aminoacyl-tRNA synthetases. Determined by X-ray diffraction at 1.8 Å resolution. Released 6 Sept 2000.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,701
Mol. weight: 36.48 kDa
Released: 6 Sept 2000

Explore 1EUJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EUJ contains 19 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	11-22	12	1
β-strand	25-34	10	1
β-strand	41-45	5	1
α-helix	53-55	3
β-strand	60-64	5	1
β-strand	67	1	2
α-helix	68-69	2
β-strand	70-72	3	3
β-strand	75-77	3	3
β-strand	80-81	2	1
β-strand	83-85	3	4
β-strand	90-92	3	4
β-strand	94	1	5
α-helix	95-96	2
β-strand	104	1	1
β-strand	106	1	6
α-helix	113-115	3
β-strand	118	1	2
α-helix	120-122	3
α-helix	124-128	5
α-helix	129-131	3
β-strand	132-134	3	7
β-strand	139	1	5
β-strand	140-142	3	7
β-strand	145-146	2	7
α-helix	147	1
β-strand	148-149	2	6
β-strand	153-154	2	6
β-strand	156	1	5
β-strand	164	1	7
β-strand	165	1	4

Chain B: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	11-21	11	8
β-strand	29-34	6	8
β-strand	41-45	5	8
α-helix	53-55	3
β-strand	59-64	6	8
β-strand	67	1	9
α-helix	68-69	2
β-strand	70-71	2	10
β-strand	76-77	2	10
β-strand	80-81	2	8
β-strand	83-85	3	11
β-strand	90-92	3	11
β-strand	94	1	12
α-helix	95-96	2
α-helix	103	1
β-strand	104	1	8
α-helix	105	1
β-strand	106	1	13
β-strand	118	1	9
α-helix	120-122	3
α-helix	124-128	5
α-helix	129-131	3
β-strand	132-134	3	11
β-strand	139	1	12
β-strand	140-142	3	11
β-strand	145-146	2	11
α-helix	147	1
β-strand	148-149	2	13
β-strand	153-154	2	13
β-strand	156	1	12
β-strand	164-165	2	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endothelial monocyte activating polypeptide 2	A, B	protein	166	Homo sapiens	Q12904 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1EUJ_1 ENDOTHELIAL MONOCYTE ACTIVATING POLYPEPTIDE 2 (chains A, B)
SKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRM
VILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNP
KKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK

Primary citation

A novel anti-tumor cytokine contains an RNA binding motif present in aminoacyl-tRNA synthetases. Kim, Y., Shin, J., Li, R. et al. J Biol Chem (2000) 275:27062-27068. PubMed

Other PDB entries of the same protein (UniProt Q12904 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FL0 1.5 Å, Crystal structure of the EMAP2/RNA-binding domain of the P43 protein from human…
1E7Z 2.05 Å, Crystal structure of the EMAP2/RNA binding domain of the p43 protein from human…
8J9S 3.01 Å, leucine zipper complex of AIMP1 and AIMP2
4R3Z 4.03 Å, Crystal structure of human ArgRS-GlnRS-AIMP1 complex
8ONG Structure of the endothelial monocyte activating polypeptide II (EMAP II) in solution

Browse structure collections

About this viewer

MolViewer shows 1EUJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.