Structure of the endothelial monocyte activating polypeptide II (EMAP II) in solution. Determined by solution NMR. Released 10 Apr 2024.
Explore 8ONG in 3D Show helices and sheets RCSB PDB PDBe
8ONG contains 7 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-7 | 3 | |
| α-helix | 9-11 | 3 | |
| β-strand | 14-18 | 5 | 1 |
| β-strand | 19-24 | 6 | 2 |
| β-strand | 32-36 | 5 | 2 |
| β-strand | 44-48 | 5 | 2 |
| β-strand | 63-67 | 5 | 1 |
| β-strand | 70 | 1 | 3 |
| α-helix | 71-72 | 2 | |
| β-strand | 74-75 | 2 | 4 |
| β-strand | 78-79 | 2 | 4 |
| β-strand | 84 | 1 | 1 |
| β-strand | 86-88 | 3 | 5 |
| β-strand | 93-95 | 3 | 5 |
| β-strand | 97 | 1 | 6 |
| β-strand | 107-108 | 2 | 1 |
| β-strand | 109 | 1 | 7 |
| β-strand | 121 | 1 | 3 |
| α-helix | 123-125 | 3 | |
| α-helix | 127-131 | 5 | |
| α-helix | 132-134 | 3 | |
| β-strand | 135-137 | 3 | 5 |
| β-strand | 142 | 1 | 6 |
| β-strand | 143-145 | 3 | 5 |
| β-strand | 148-149 | 2 | 5 |
| β-strand | 151 | 1 | 8 |
| β-strand | 152 | 1 | 7 |
| β-strand | 157 | 1 | 8 |
| β-strand | 159 | 1 | 6 |
| α-helix | 166 | 1 | |
| β-strand | 167-168 | 2 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 | A | protein | 169 | Homo sapiens | Q12904 (AlphaFold model) |
>8ONG_1 Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (chains A) AMDSKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQ NRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKE LNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK
Solution 3D structure and conformational flexibility of the endothelial monocyte activating polypeptide II (EMAP II) revealed by NMR spectroscopy and molecular dynamics simulations. Lozhko, D., Kolomiiets, L., Zhukova, L. et al. J Struct Biol (2026) 218:108280-108280. DOI 10.1016/j.jsb.2025.108280 · PubMed
Other PDB entries of the same protein (UniProt Q12904 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8ONG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.