1EWC: ZN2+ loaded staphylococcal enterotoxin H

Name: PDB 1EWC: Crystal structure of ZN2+ loaded staphylococcal enterotoxin H
Published: 2000-05-31
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Crystal structure of ZN2+ loaded staphylococcal enterotoxin H. Determined by X-ray diffraction at 1.95 Å resolution. Released 31 May 2000.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Staphylococcus aureus
Chains: 1
Atoms: 1,882
Mol. weight: 24.82 kDa
Ligands: ZN
Released: 31 May 2000

Explore 1EWC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EWC contains 12 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	6-8	3
α-helix	11-22	12
β-strand	25-30	6	1
β-strand	35-36	2	2
β-strand	40-43	4	2
α-helix	48-50	3
β-strand	52-56	5	2
α-helix	60-66	7
β-strand	71-75	5	1
β-strand	77-78	2	2
α-helix	82-84	3
α-helix	89	1
β-strand	90-94	5	2
β-strand	97-99	3	1
β-strand	103-116	14	3
β-strand	119-120	2	3
α-helix	122-123	2
β-strand	124-130	7	3
β-strand	132-134	3	4
α-helix	135-150	16
β-strand	159-168	10	3
β-strand	173-177	5	3
α-helix	186-189	4
α-helix	190-193	4
β-strand	198-200	3	4
α-helix	201-203	3
β-strand	204-213	10	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Enterotoxin H	A	protein	214	Staphylococcus aureus	P0A0M0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1EWC_1 ENTEROTOXIN H (chains A)
DLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATAD
LAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQK
ETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDL
GGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules. Hakansson, M., Petersson, K., Nilsson, H. et al. J Mol Biol (2000) 302:527-537. DOI 10.1006/jmbi.2000.4093 · PubMed

Other PDB entries of the same protein (UniProt P0A0M0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ENF 1.69 Å, Crystal structure of staphylococcal enterotoxin H determined to 1.69 a resolution
2XNA 2.1 Å, Crystal structure of the complex between human T cell receptor and staphylococcal…
2XN9 2.3 Å, Crystal structure of the ternary complex between human T cell receptor, staphylococcal…
1F77 2.4 Å, Staphylococcal enterotoxin H determined to 2.4 a resolution
1HXY 2.6 Å, Crystal structure of staphylococcal enterotoxin H in complex with human MHC class II

Browse structure collections

About this viewer

MolViewer shows 1EWC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.