2XNA: T cell receptor alpha chain C region

Crystal structure of the complex between human T cell receptor and staphylococcal enterotoxin. Determined by X-ray diffraction at 2.1 Å resolution. Released 24 Nov 2010.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: HOMO SAPIENS, STAPHYLOCOCCUS AUREUS
Chains: 3
Atoms: 5,550
Mol. weight: 75.58 kDa
Released: 24 Nov 2010

Explore 2XNA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XNA contains 22 α-helices and 60 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
β-strand	10-14	5	2
β-strand	19-24	6	1
β-strand	32-37	6	2
β-strand	44-49	6	2
β-strand	55-58	4	1
β-strand	61-65	5	1
β-strand	71-76	6	1
α-helix	81-83	3
β-strand	85-92	8	2
β-strand	98-100	3	2
β-strand	104-109	6	2
α-helix	110-112	3
β-strand	118-123	6	3
β-strand	124	1	4
β-strand	131-136	6	3
α-helix	145-147	3
β-strand	153-154	2	3
α-helix	155-157	3
β-strand	158-162	5	3
α-helix	163-165	3
β-strand	167-175	9	3
α-helix	183-186	4
β-strand	197	1	3

Chain B: 6 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	6-9	4	5
β-strand	12-16	5	6
β-strand	21-23	3	7
β-strand	24-27	4	5
β-strand	33-40	8	6
β-strand	44-53	10	6
β-strand	56-59	4	6
β-strand	66-68	3	7
β-strand	75	1	5
β-strand	78-80	3	7
β-strand	89-96	8	6
β-strand	104-105	2	6
β-strand	109-114	6	6
α-helix	117-119	3
β-strand	121	1	8
β-strand	124-128	5	4
α-helix	129-131	3
α-helix	132-138	7
β-strand	140-150	11	4
β-strand	151	1	8
β-strand	155-161	7	9
β-strand	164-166	3	9
β-strand	170-172	3	4
α-helix	176	1
β-strand	177-178	2	4
β-strand	188-197	10	4
α-helix	198-201	4
β-strand	207-214	8	9
β-strand	217	1	10
α-helix	228-229	2
β-strand	231	1	10
β-strand	233-240	8	9

Chain C: 10 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	6-8	3
α-helix	11-22	12
β-strand	25-30	6	11
β-strand	35-36	2	12
β-strand	40-43	4	12
α-helix	48-50	3
β-strand	52-56	5	12
α-helix	60-66	7
β-strand	71-75	5	11
β-strand	78	1	12
β-strand	90-94	5	12
β-strand	97-99	3	11
β-strand	103-116	14	13
β-strand	119-120	2	13
α-helix	122-123	2
β-strand	124-130	7	13
β-strand	132-134	3	14
α-helix	135-150	16
β-strand	159-168	10	13
β-strand	174-177	4	13
α-helix	186-189	4
α-helix	190-193	4
β-strand	198-200	3	14
α-helix	201-203	3
β-strand	204-213	10	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T cell receptor alpha chain C region	A	protein	204	HOMO SAPIENS	P01848 (AlphaFold model)
T cell receptor beta-1 chain C region	B	protein	244	HOMO SAPIENS	P01850 (AlphaFold model)
Enterotoxin H	C	protein	217	STAPHYLOCOCCUS AUREUS	P0A0M0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2XNA_1 T CELL RECEPTOR ALPHA CHAIN C REGION (chains A)
MQLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKR
LTFQFGDARKDSSLHITAAQPGDTGLYLCAGAGSQGNLIFGKGTKLSVKPNIQNPDPAVY
QLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSD
FACANAFNNSIIPEDTFFPSPESS

Sequence of entity 2 (B), FASTA

>2XNA_2 T CELL RECEPTOR BETA-1 CHAIN C REGION (chains B)
MVDGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKG
DIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSSRSSYEQYFGPGTRLTVTEDLKNV
FPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQ
PALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAW
GRAD

Sequence of entity 3 (C), FASTA

>2XNA_3 ENTEROTOXIN H (chains C)
EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATA
DLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQ
KETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYD
LKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV

Primary citation

The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation. Saline, M., Rodstrom, K.E.J., Fischer, G. et al. Nat Commun (2010) 1:119. DOI 10.1038/NCOMMS1117 · PubMed

Other PDB entries of the same protein (UniProt P01848 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UDT 1.35 Å, T cell receptor (TRAV22,TRBV7-9) structure
4WW1 1.38 Å, Crystal structure of human TCR Alpha Chain-TRAV21-TRAJ8 and Beta Chain-TRBV7-8
1OGA 1.4 Å, A structural basis for immunodominant human T-cell receptor recognition.
2BNU 1.4 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
1KGC 1.5 Å, Immune Receptor
2BNQ 1.7 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
2BNR 1.9 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
2IAL 1.92 Å, Structural basis for recognition of mutant self by a tumor-specific, MHC class…
5C0C 1.97 Å, 1E6 TCR in complex with HLA-A02 carrying RQFGPDWIVA
2VLM 1.98 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5KSA 2.0 Å, Bel602-DQ8.5-glia-gamma1 complex
7RYL 2.0 Å, T cell receptor CO3

Browse structure collections

About this viewer

MolViewer shows 2XNA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.