1F11: F124 immunoglobulin

F124 FAB fragment from a monoclonal anti-PRES2 antibody. Determined by X-ray diffraction at 3.0 Å resolution. Released 30 Aug 2000.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Mus musculus
Chains: 4
Atoms: 6,598
Mol. weight: 95.16 kDa
Released: 30 Aug 2000

Explore 1F11 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1F11 contains 30 α-helices and 92 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	27C	1	3
β-strand	31	1	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-107	6	2
β-strand	111	1	4
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	5
β-strand	140	1	4
β-strand	145-150	6	6
β-strand	153-155	3	6
β-strand	159-163	5	5
α-helix	164-167	4
β-strand	173-182	10	5
α-helix	183-187	5
β-strand	191-197	7	6
β-strand	205-210	6	6

Chain B: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
β-strand	10-12	3	8
β-strand	18-25	8	7
β-strand	34-39	6	8
β-strand	45-52	8	8
β-strand	56-59	4	8
α-helix	61-63	3
β-strand	64	1	7
β-strand	67-72	6	7
α-helix	73-75	3
β-strand	77-82	6	7
α-helix	84-86	3
β-strand	88-94	7	8
β-strand	102-103	2	8
β-strand	107-111	5	8
α-helix	115-116	2
β-strand	117	1	9
β-strand	120-124	5	10
β-strand	138-147	10	10
β-strand	148	1	9
β-strand	153-157	4	11
α-helix	162-164	3
β-strand	166	1	11
β-strand	171-173	3	10
α-helix	174-176	3
β-strand	177-179	3	10
β-strand	184-193	10	10
α-helix	199-203	4
β-strand	207-212	6	11
α-helix	213-215	3
β-strand	217-222	6	11

Chain C: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	12
β-strand	10-14	5	13
β-strand	19-25	7	12
β-strand	27C-27D	2	14
β-strand	30-31	2	14
β-strand	33-38	6	13
β-strand	45-49	5	13
β-strand	53-54	2	13
β-strand	62-67	6	12
β-strand	70-75	6	12
α-helix	80-82	3
β-strand	84-90	7	13
α-helix	96	1
β-strand	97-98	2	13
β-strand	102-107	6	13
β-strand	111	1	15
β-strand	114-118	5	16
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	16
β-strand	140	1	15
β-strand	145-150	6	17
β-strand	153-155	3	17
β-strand	159-163	5	16
α-helix	164-167	4
β-strand	173-182	10	16
α-helix	183-187	5
β-strand	191-197	7	17
β-strand	205-210	6	17

Chain D: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	18
β-strand	10-12	3	19
β-strand	18-25	8	18
α-helix	29-31	3
β-strand	34-39	6	19
β-strand	45-52	8	19
β-strand	56-59	4	19
α-helix	61-63	3
β-strand	64	1	18
β-strand	67-72	6	18
α-helix	73-75	3
β-strand	77-82	6	18
α-helix	84-86	3
β-strand	88-94	7	19
β-strand	102-103	2	19
β-strand	107-111	5	19
α-helix	115-116	2
β-strand	117	1	20
β-strand	120-124	5	21
β-strand	138-147	10	21
β-strand	148	1	20
β-strand	153-157	4	22
α-helix	162-164	3
β-strand	166	1	22
β-strand	172-173	2	21
α-helix	174-176	3
β-strand	177-179	3	21
β-strand	184-193	10	21
α-helix	199-203	4
β-strand	207-212	6	22
α-helix	213-215	3
β-strand	217-222	6	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F124 immunoglobulin (kappa light chain)	A, C	protein	218	Mus musculus	P01665 (AlphaFold model), P01837 (AlphaFold model)
F124 immunoglobulin (IgG1 heavy chain)	B, D	protein	221	Mus musculus	P01869 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1F11_1 F124 IMMUNOGLOBULIN (KAPPA LIGHT CHAIN) (chains A, C)
DMVLTQSPASLAVSLGQRATISCKASQSVDYDGDSYMNWYQQKPGQPPKLLIYVASNLKS
GIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQSNEDPFTFGSGTKLEIKRADAAPTVS
IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS
STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (B, D), FASTA

>1F11_2 F124 IMMUNOGLOBULIN (IGG1 HEAVY CHAIN) (chains B, D)
EVQLQQSGPELVKPGASVKMSCKASGYTFTDYYMKWVKQSHGKSLEWIGDINPNNGGTGY
NQKFKGKATLTVDKSSSTAYMQLNSLTSEDSAVYYCANDYGSTYGFAYWGQGTLVTVSAA
KTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC

Primary citation

Structure of the Fab fragment from F124, a monoclonal antibody specific for hepatitis B surface antigen. Saul, F.A., Vulliez-Le Normand, B., Passafiume, M. et al. Acta Crystallogr D Biol Crystallogr (2000) 56:945-951. DOI 10.1107/S0907444900008088 · PubMed

Other PDB entries of the same protein (UniProt P01665 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZCH 2.83 Å, Crystal structure of human prostate specific antigen complexed with an activating antibody
2ZCK 3.1 Å, Crystal structure of a ternary complex between PSA, a substrat-acyl intermediate and an…
2ZCL 3.25 Å, Crystal structure of human prostate specific antigen complexed with an activating antibody
1QNZ NMR structure of the 0.5b anti-HIV antibody complex with the gp120 V3 peptide

Browse structure collections

About this viewer

MolViewer shows 1F11 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.