1F2H: PDB entry 1F2H

Solution structure of the N-terminal domain of the TNFR1 associated protein, tradd. Determined by solution NMR. Released 30 May 2001.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,301
Mol. weight: 18.57 kDa
Released: 30 May 2001

Explore 1F2H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1F2H contains 6 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	14-20	7	1
α-helix	28-31	4
α-helix	35-52	18
β-strand	61-67	7	1
β-strand	70-76	7	1
α-helix	80-107	28
β-strand	115-119	5	1
α-helix	125-130	6
α-helix	132-141	10
α-helix	150-162	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor type 1 associated death domain protein	A	protein	169	Homo sapiens	Q15628 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1F2H_1 TUMOR NECROSIS FACTOR RECEPTOR TYPE 1 ASSOCIATED DEATH DOMAIN PROTEIN (chains A)
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGAR

Primary citation

Solution structure of N-TRADD and characterization of the interaction of N-TRADD and C-TRAF2, a key step in the TNFR1 signaling pathway. Tsao, D.H., McDonagh, T., Telliez, J.B. et al. Mol Cell (2000) 5:1051-1057. DOI 10.1016/S1097-2765(00)80270-1 · PubMed

Other PDB entries of the same protein (UniProt Q15628 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AC0 1.45 Å, Crystal structure of TRADD death domain GlcNAcylated by EPEC effector NleB
1F3V 2.0 Å, Crystal structure of the complex between the N-terminal domain of TRADD and the TRAF…
9VGD 3.3 Å, Helical assembly of TRADD death domain
9VIN 3.41 Å, Ternary complex of TNFR1-DD, TRADD-DD and RIPK1-DD
5XME Solution structure of C-terminal domain of TRADD
7CSQ Solution structure of the complex between p75NTR-DD and TRADD-DD

Browse structure collections

About this viewer

MolViewer shows 1F2H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.