7CSQ: Complex between p75NTR-DD and TRADD-DD

Solution structure of the complex between p75NTR-DD and TRADD-DD. Determined by solution NMR. Released 25 Aug 2021.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,650
Mol. weight: 23.47 kDa
Released: 25 Aug 2021

Explore 7CSQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CSQ contains 15 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	335	1	1
α-helix	336-338	3
α-helix	341-350	10
α-helix	359-366	8
α-helix	370-376	7
α-helix	382-390	9
β-strand	397	1	1
α-helix	398-407	10
α-helix	411-418	8

Chain B: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	201-204	4	2
β-strand	207-210	4	2
α-helix	216-226	11
α-helix	227-229	3
α-helix	230-240	11
α-helix	242-244	3
α-helix	248-255	8
α-helix	261-275	15
α-helix	282-291	10
α-helix	295-300	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor superfamily member 16	A	protein	98	Homo sapiens	P08138 (AlphaFold model)
Tumor necrosis factor receptor type 1-associated DEATH domain protein	B	protein	114	Homo sapiens	Q15628 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7CSQ_1 Tumor necrosis factor receptor superfamily member 16 (chains A)
KGDGGLYSSLPPAKREEVEKLLNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLAS
WATQDSATLDALLAALRRIQRADLVESLCSESTATSPV

Sequence of entity 2 (B), FASTA

>7CSQ_2 Tumor necrosis factor receptor type 1-associated DEATH domain protein (chains B)
AQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYER
EGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA

Primary citation

Structural basis of NF-kappa B signaling by the p75 neurotrophin receptor interaction with adaptor protein TRADD through their respective death domains. Zhang, N., Kisiswa, L., Ramanujan, A. et al. J Biol Chem (2021) 297:100916-100916. DOI 10.1016/j.jbc.2021.100916 · PubMed

Other PDB entries of the same protein (UniProt P08138 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EWV 2.6 Å, Crystal Structure of calmodulin complexed with a peptide
2N80 p75NTR DD:RhoGDI
2N83 p75NTR DD:RIP2 card
2N97 DD homodimer
5ZGG NMR structure of p75NTR transmembrane domain in complex with NSC49652
8X8T NMR structure of p75NTR juxtamembrane domain in complex with RhoGDI N-terminal domain…

Browse structure collections

About this viewer

MolViewer shows 7CSQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.