9VGD: Helical assembly of TRADD death domain

Helical assembly of TRADD death domain. Determined by electron microscopy at 3.3 Å resolution. Released 8 Apr 2026.

Method: Electron microscopy
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 28
Atoms: 24,584
Mol. weight: 362.23 kDa
Released: 8 Apr 2026

Explore 9VGD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9VGD contains 241 α-helices and 112 β-strands across 28 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, g, J, Q and R: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	201-204	4	1
β-strand	207-210	4	1
β-strand	213	1	2
α-helix	216-224	9
α-helix	227-229	3
α-helix	230-237	8
α-helix	248-255	8
α-helix	257-259	3
α-helix	261-276	16
α-helix	277-279	3
β-strand	281	1	2
α-helix	282-291	10
α-helix	295-302	8

Chains b, h, M and S: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	201-204	4	43
β-strand	207-210	4	43
β-strand	213	1	44
α-helix	216-224	9
α-helix	227-229	3
α-helix	230-238	9
α-helix	248-255	8
α-helix	257-259	3
α-helix	261-276	16
α-helix	277-279	3
β-strand	281	1	44
α-helix	282-291	10
α-helix	295-302	8

Chain B: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	201-204	4	5
β-strand	207-210	4	5
β-strand	213	1	6
α-helix	216-225	10
α-helix	227-229	3
α-helix	230-237	8
α-helix	248-255	8
α-helix	257-259	3
α-helix	261-276	16
α-helix	277-279	3
β-strand	281	1	6
α-helix	282-291	10
α-helix	295-302	8

Chains c, j and N: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	201-204	4	45
β-strand	207-210	4	45
β-strand	213	1	46
α-helix	216-224	9
α-helix	227-229	3
α-helix	230-237	8
α-helix	248-255	8
α-helix	261-276	16
α-helix	277-279	3
β-strand	281	1	46
α-helix	282-291	10
α-helix	295-302	8

Chain C: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	201-204	4	9
β-strand	207-210	4	9
β-strand	213	1	10
α-helix	216-223	8
α-helix	227-229	3
α-helix	230-238	9
α-helix	248-255	8
α-helix	257-259	3
α-helix	261-276	16
α-helix	277-279	3
β-strand	281	1	10
α-helix	282-291	10
α-helix	295-301	7

Chain e: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	201-204	4	47
β-strand	207-210	4	47
β-strand	213	1	48
α-helix	216-224	9
α-helix	227-229	3
α-helix	230-238	9
α-helix	248-255	8
α-helix	261-276	16
α-helix	277-279	3
β-strand	281	1	48
α-helix	282-291	10
α-helix	295-302	8

Chains E and Z: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	201-204	4	11
β-strand	207-210	4	11
β-strand	213	1	12
α-helix	216-225	10
α-helix	227-229	3
α-helix	230-238	9
α-helix	248-255	8
α-helix	257-259	3
α-helix	261-276	16
α-helix	277-279	3
β-strand	281	1	12
α-helix	282-291	10
α-helix	295-302	8

Chain f: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	201-204	4	49
β-strand	207-210	4	49
β-strand	213	1	50
α-helix	216-225	10
α-helix	227-229	3
α-helix	230-237	8
α-helix	248-255	8
α-helix	261-276	16
α-helix	277-279	3
β-strand	281	1	50
α-helix	282-291	10
α-helix	295-302	8

7 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor type 1-associated DEATH domain protein	A, B, C, E, F, H, I, J, K, M, N, Q, R, S, T, V, W, Y, Z, b, c, e, f, g, h, j, k, l	protein	114	Homo sapiens	Q15628 (AlphaFold model)

Sequence of entity 1 (A, B, C, E, F, H, I, J, K, M, N, Q, R, S, T, V, W, Y, Z, b, c, e, f, g, h, j, k, l), FASTA

>9VGD_1 Tumor necrosis factor receptor type 1-associated DEATH domain protein (chains A, B, C, E, F, H, I, J, K, M, N, Q, R, S, T, V, W, Y, Z, b, c, e, f, g, h, j, k, l)
AQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYER
EGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA

Primary citation

Electric dipole moment drives the dynamics of the TNFR1 complex I signalosome. Liu, J., Zhao, J., Gao, J. et al. Nature (2026) 653:1196-1204. DOI 10.1038/s41586-026-10304-1 · PubMed

Other PDB entries of the same protein (UniProt Q15628 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AC0 1.45 Å, Crystal structure of TRADD death domain GlcNAcylated by EPEC effector NleB
1F3V 2.0 Å, Crystal structure of the complex between the N-terminal domain of TRADD and the TRAF…
9VIN 3.41 Å, Ternary complex of TNFR1-DD, TRADD-DD and RIPK1-DD
1F2H Solution structure of the N-terminal domain of the TNFR1 associated protein, tradd.
5XME Solution structure of C-terminal domain of TRADD
7CSQ Solution structure of the complex between p75NTR-DD and TRADD-DD

Browse structure collections

About this viewer

MolViewer shows 9VGD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.