Crystal structure of the human high-affinity IgE receptor. Determined by X-ray diffraction at 2.4 Å resolution. Released 8 Jun 2000.
Explore 1F2Q in 3D Show helices and sheets RCSB PDB PDBe
1F2Q contains 5 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-10 | 3 | 1 |
| β-strand | 15-17 | 3 | 2 |
| β-strand | 22-25 | 4 | 1 |
| β-strand | 38-41 | 4 | 3 |
| β-strand | 44-45 | 2 | 3 |
| β-strand | 52-55 | 4 | 1 |
| α-helix | 60-62 | 3 | |
| β-strand | 64-69 | 6 | 3 |
| α-helix | 75-78 | 4 | |
| β-strand | 79-81 | 3 | 3 |
| β-strand | 82-84 | 3 | 2 |
| β-strand | 88-92 | 5 | 4 |
| β-strand | 96-98 | 3 | 5 |
| β-strand | 103-109 | 7 | 4 |
| α-helix | 110-112 | 3 | |
| β-strand | 115-122 | 8 | 6 |
| β-strand | 125-126 | 2 | 6 |
| β-strand | 135-138 | 4 | 4 |
| α-helix | 143-145 | 3 | |
| β-strand | 147-155 | 9 | 6 |
| β-strand | 158-161 | 4 | 6 |
| α-helix | 162-164 | 3 | |
| β-strand | 165-167 | 3 | 6 |
| β-strand | 168-170 | 3 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| High affinity immunoglobulin epsilon receptor alpha-subunit | A | protein | 176 | Homo sapiens | P12319 (AlphaFold model) |
>1F2Q_1 HIGH AFFINITY IMMUNOGLOBULIN EPSILON RECEPTOR ALPHA-SUBUNIT (chains A) VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKF EDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIY YKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREK
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Crystal structure of the human high-affinity IgE receptor. Garman, S.C., Kinet, J.P., Jardetzky, T.S. Cell (1998) 95:951-961. DOI 10.1016/S0092-8674(00)81719-5 · PubMed
Other PDB entries of the same protein (UniProt P12319 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1F2Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.