1F3G: Escherichia coli phosphocarrier protein III glc

Three-dimensional structure of the escherichia coli phosphocarrier protein III glc. Determined by X-ray diffraction at 2.1 Å resolution. Released 31 Oct 1993.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Escherichia coli
Chains: 1
Atoms: 1,137
Mol. weight: 17.34 kDa
Released: 31 Oct 1993

Explore 1F3G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1F3G contains 6 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	20-23	4	1
α-helix	24	1
β-strand	28-32	5	2
α-helix	33-35	3
α-helix	39-42	4
β-strand	48-54	7	2
β-strand	58-60	3	3
β-strand	65-70	6	2
β-strand	76-81	6	2
β-strand	86-90	5	2
β-strand	93	1	4
α-helix	95-98	4
β-strand	103-105	3	3
β-strand	112-113	2	2
β-strand	118-122	5	3
α-helix	124-130	7
β-strand	133	1	4
β-strand	136-140	5	2
α-helix	143-145	3
β-strand	148-151	4	1
β-strand	155-156	2	2
β-strand	162-167	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucose-specific phosphocarrier protein iiaglc	A	protein	161	Escherichia coli	P69783 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1F3G_1 GLUCOSE-SPECIFIC PHOSPHOCARRIER PROTEIN IIAGLC (chains A)
SLVSDDKKDTGTIEIIAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPTGNKMVAPVDGTI
GKIFETNHAFSIESDSGVELFVHFGIDTVELKGEGFKRIAEEGQRVKVGDTVIEFDLPLL
EEKAKSTLTPVVISNMDEIKELIKLSGSVTVGETPVIRIKK

Primary citation

Three-dimensional structure of the Escherichia coli phosphocarrier protein IIIglc. Worthylake, D., Meadow, N.D., Roseman, S. et al. Proc Natl Acad Sci U S A (1991) 88:10382-10386. DOI 10.1073/pnas.88.23.10382 · PubMed

Other PDB entries of the same protein (UniProt P69783 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F3Z 1.98 Å, Iiaglc-ZN complex
2F3G 2.13 Å, Iiaglc crystal form III
1GLA 2.6 Å, Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase
1GLB 2.6 Å, Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase
1GLC 2.65 Å, Cation promoted association (CPA) of a regulatory and target protein is controlled by…
1GLD 2.93 Å, Cation promoted association (CPA) of a regulatory and target protein is controlled by…
1GLE 2.94 Å, Cation promoted association (CPA) of a regulatory and target protein is controlled by…
4JBW 3.91 Å, Crystal structure of E. coli maltose transporter MalFGK2 in complex with its regulatory…
1GGR Complex of enzyme iiaglc and the histidine-containing phosphocarrier protein hpr from…
1O2F Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli…
2MP0 Protein Phosphorylation upon a Fleeting Encounter

Browse structure collections

About this viewer

MolViewer shows 1F3G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.