2F3G: Iiaglc crystal form III

Iiaglc crystal form III. Determined by X-ray diffraction at 2.13 Å resolution. Released 28 Jan 1998.

Method: X-ray diffraction
Resolution: 2.13 Å
Organism: Escherichia coli
Chains: 2
Atoms: 2,333
Mol. weight: 36.28 kDa
Released: 28 Jan 1998

Explore 2F3G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2F3G contains 12 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	20-23	4	1
α-helix	24	1
β-strand	28-31	4	2
α-helix	33-35	3
α-helix	39-42	4
β-strand	48-54	7	2
β-strand	58-60	3	3
β-strand	65-70	6	2
β-strand	76-81	6	2
β-strand	86-90	5	2
β-strand	93	1	4
α-helix	95-98	4
β-strand	103-105	3	3
β-strand	112-113	2	2
β-strand	118-122	5	3
α-helix	124-130	7
β-strand	133	1	4
β-strand	136-140	5	2
α-helix	143-145	3
β-strand	148-151	4	1
β-strand	155-156	2	2
β-strand	162-167	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucose-specific phosphocarrier	A, B	protein	168	Escherichia coli	P69783 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2F3G_1 GLUCOSE-SPECIFIC PHOSPHOCARRIER (chains A, B)
GLFDKLKSLVSDDKKDTGTIEIIAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPTGNKMV
APVDGTIGKIFETNHAFSIESDSGVELFVHFGIDTVELKGEGFKRIAEEGQRVKVGDTVI
EFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSGSVTVGETPVIRIKK

Primary citation

Structural studies of the Escherichia coli signal transducing protein IIAGlc: implications for target recognition. Feese, M.D., Comolli, L., Meadow, N.D. et al. Biochemistry (1997) 36:16087-16096. DOI 10.1021/bi971999e · PubMed

Other PDB entries of the same protein (UniProt P69783 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F3Z 1.98 Å, Iiaglc-ZN complex
1F3G 2.1 Å, Three-dimensional structure of the escherichia coli phosphocarrier protein III glc
1GLA 2.6 Å, Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase
1GLB 2.6 Å, Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase
1GLC 2.65 Å, Cation promoted association (CPA) of a regulatory and target protein is controlled by…
1GLD 2.93 Å, Cation promoted association (CPA) of a regulatory and target protein is controlled by…
1GLE 2.94 Å, Cation promoted association (CPA) of a regulatory and target protein is controlled by…
4JBW 3.91 Å, Crystal structure of E. coli maltose transporter MalFGK2 in complex with its regulatory…
1GGR Complex of enzyme iiaglc and the histidine-containing phosphocarrier protein hpr from…
1O2F Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli…
2MP0 Protein Phosphorylation upon a Fleeting Encounter

Browse structure collections

About this viewer

MolViewer shows 2F3G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.