1F70: Calmodulin N-terminal domain

Refined solution structure of calmodulin N-terminal domain. Determined by solution NMR. Released 22 Sept 2000.

Method: Solution NMR
Organism: Xenopus laevis
Chains: 1
Atoms: 588
Mol. weight: 8.45 kDa
Released: 22 Sept 2000

Explore 1F70 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1F70 contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	6-18	13
β-strand	26-28	3	1
α-helix	29-31	3
α-helix	32-39	8
α-helix	45-55	11
β-strand	62-64	3	1
α-helix	65-75	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A	protein	76	Xenopus laevis	P0DP33 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1F70_1 CALMODULIN (chains A)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN
GTIDFPEFLTMMARKM

Primary citation

Study of conformational rearrangement and refinement of structural homology models by the use of heteronuclear dipolar couplings. Chou, J.J., Li, S., Bax, A. J Biomol NMR (2000) 18:217-227. DOI 10.1023/A:1026563923774 · PubMed

Other PDB entries of the same protein (UniProt P0DP33 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IQ5 1.8 Å, Calmodulin/nematode CA2+/Calmodulin dependent kinase kinase fragment
2COL 2.2 Å, Crystal structure analysis of CyaA/C-Cam with Pyrophosphate
4R8G 3.5 Å, Crystal Structure of Myosin-1c tail in complex with Calmodulin
1Y0V 3.6 Å, Crystal structure of anthrax edema factor (EF) in complex with calmodulin and…
1CFC Calcium-free calmodulin
1CFD Calcium-free calmodulin
1CFF NMR solution structure of a complex of calmodulin with a binding peptide of the CA2+-pump
1CKK Calmodulin/rat CA2+/CALMODULIN dependent protein kinase fragment
1DMO Calmodulin, NMR, 30 structures
1F71 Refined solution structure of calmodulin C-terminal domain
1MUX Solution NMR structure of calmodulin/w-7 complex: the basis of diversity in molecular…
1NWD Solution Structure of Ca2+/Calmodulin bound to the C-terminal Domain of Petunia…

Browse structure collections

About this viewer

MolViewer shows 1F70 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.