1F77: Enterotoxin H

Name: PDB 1F77: Staphylococcal enterotoxin H determined to 2.4 a resolution
Published: 2000-07-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Staphylococcal enterotoxin H determined to 2.4 a resolution. Determined by X-ray diffraction at 2.4 Å resolution. Released 19 Jul 2000.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Staphylococcus aureus
Chains: 2
Atoms: 3,659
Mol. weight: 51.03 kDa
Released: 19 Jul 2000

Explore 1F77 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1F77 contains 18 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	6-8	3
α-helix	11-22	12
β-strand	25-31	7	1
β-strand	35-36	2	2
β-strand	40-43	4	2
α-helix	48-50	3
β-strand	52-56	5	2
α-helix	60-65	6
β-strand	70-75	6	1
β-strand	78	1	2
β-strand	90-94	5	2
β-strand	97-99	3	1
β-strand	103-116	14	3
β-strand	119-130	12	3
β-strand	132-134	3	4
α-helix	135-149	15
β-strand	161-168	8	3
β-strand	173-177	5	3
α-helix	186-189	4
α-helix	190-193	4
β-strand	198-200	3	4
α-helix	201-203	3
β-strand	204-212	9	3

Chain B: 9 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	6-8	3
α-helix	11-22	12
β-strand	25-31	7	5
β-strand	35-36	2	6
β-strand	40-43	4	6
α-helix	48-50	3
β-strand	53-56	4	6
α-helix	60-66	7
β-strand	70-75	6	5
β-strand	77-78	2	6
β-strand	86	1	7
β-strand	88	1	7
β-strand	91-94	4	6
β-strand	97-99	3	5
β-strand	103-116	14	8
β-strand	119-130	12	8
β-strand	132-134	3	9
α-helix	135-150	16
β-strand	161-168	8	8
β-strand	173-177	5	8
α-helix	186-189	4
α-helix	190-193	4
β-strand	198-200	3	9
α-helix	201-203	3
β-strand	204-212	9	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Enterotoxin H	A, B	protein	217	Staphylococcus aureus	P0A0M0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1F77_1 ENTEROTOXIN H (chains A, B)
EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATA
DLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQ
KETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYD
LKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV

Primary citation

The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules. Hakansson, M., Petersson, K., Nilsson, H. et al. J Mol Biol (2000) 302:527-537. DOI 10.1006/jmbi.2000.4093 · PubMed

Other PDB entries of the same protein (UniProt P0A0M0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ENF 1.69 Å, Crystal structure of staphylococcal enterotoxin H determined to 1.69 a resolution
1EWC 1.95 Å, Crystal structure of ZN2+ loaded staphylococcal enterotoxin H
2XNA 2.1 Å, Crystal structure of the complex between human T cell receptor and staphylococcal…
2XN9 2.3 Å, Crystal structure of the ternary complex between human T cell receptor, staphylococcal…
1HXY 2.6 Å, Crystal structure of staphylococcal enterotoxin H in complex with human MHC class II

Browse structure collections

About this viewer

MolViewer shows 1F77 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.