1FFX: Tubulin:stathmin-like domain complex
Tubulin:stathmin-like domain complex. Determined by X-ray diffraction at 3.95 Å resolution. Released 27 Sept 2000.
- Method
- X-ray diffraction
- Resolution
- 3.95 Å
- Organisms
- Bos taurus, Rattus norvegicus
- Chains
- 5
- Atoms
- 13,568
- Mol. weight
- 209.75 kDa
- Ligands
- GDP, GTP
- Released
- 27 Sept 2000
Explore 1FFX in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1FFX contains 81 α-helices and 66 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 21 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-4 | 2 | |
| β-strand | 5-9 | 5 | 1 |
| α-helix | 11-18 | 8 | |
| β-strand | 66-68 | 3 | 1 |
| α-helix | 74-76 | 3 | |
| β-strand | 102 | 1 | 2 |
| α-helix | 104-107 | 4 | |
| α-helix | 118-123 | 6 | |
| β-strand | 135-138 | 4 | 1 |
| α-helix | 150-160 | 11 | |
| β-strand | 167-168 | 2 | 1 |
| α-helix | 183-190 | 8 | |
| α-helix | 209-215 | 7 | |
| α-helix | 224-236 | 13 | |
| α-helix | 240-242 | 3 | |
| α-helix | 253-255 | 3 | |
| α-helix | 268 | 1 | |
| β-strand | 269-272 | 4 | 3 |
| α-helix | 294-296 | 3 | |
| α-helix | 298-300 | 3 | |
| β-strand | 301 | 1 | 3 |
| α-helix | 307-309 | 3 | |
| β-strand | 312 | 1 | 4 |
| β-strand | 316 | 1 | 3 |
| β-strand | 318-320 | 3 | 5 |
| α-helix | 325-336 | 12 | |
| β-strand | 343 | 1 | 4 |
| β-strand | 354-355 | 2 | 5 |
| β-strand | 374-375 | 2 | 5 |
| β-strand | 376-379 | 4 | 3 |
| α-helix | 384-387 | 4 | |
| α-helix | 390-392 | 3 | |
| α-helix | 393-396 | 4 | |
| α-helix | 403-406 | 4 | |
| β-strand | 410 | 1 | 6 |
| β-strand | 412 | 1 | 6 |
| α-helix | 427-431 | 5 | |
Chain B: 16 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-4 | 2 | 7 |
| β-strand | 7-9 | 3 | 7 |
| α-helix | 11-23 | 13 | |
| β-strand | 66-68 | 3 | 7 |
| β-strand | 92 | 1 | 7 |
| α-helix | 114-121 | 8 | |
| α-helix | 123-126 | 4 | |
| β-strand | 132-139 | 8 | 7 |
| α-helix | 150-157 | 8 | |
| β-strand | 165-172 | 8 | 7 |
| α-helix | 186-188 | 3 | |
| β-strand | 202 | 1 | 8 |
| β-strand | 203-205 | 3 | 7 |
| α-helix | 206-211 | 6 | |
| α-helix | 212-216 | 5 | |
| α-helix | 229-235 | 7 | |
| α-helix | 254-258 | 5 | |
| β-strand | 268 | 1 | 8 |
| β-strand | 269-271 | 3 | 9 |
| α-helix | 284-286 | 3 | |
| α-helix | 288-294 | 7 | |
| α-helix | 298-300 | 3 | |
| β-strand | 312-316 | 5 | 9 |
| β-strand | 319 | 1 | 10 |
| β-strand | 320 | 1 | 11 |
| α-helix | 325-336 | 12 | |
| β-strand | 352 | 1 | 9 |
| β-strand | 355 | 1 | 10 |
| β-strand | 374 | 1 | 11 |
| β-strand | 377-381 | 5 | 9 |
| α-helix | 386-389 | 4 | |
| α-helix | 395-399 | 5 | |
| α-helix | 428-436 | 9 | |
Chain C: 21 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-4 | 2 | |
| β-strand | 5-6 | 2 | 12 |
| β-strand | 7-9 | 3 | 13 |
| α-helix | 11-18 | 8 | |
| β-strand | 66-68 | 3 | 13 |
| α-helix | 74-76 | 3 | |
| β-strand | 102 | 1 | 14 |
| α-helix | 104-107 | 4 | |
| α-helix | 118-126 | 9 | |
| β-strand | 135-138 | 4 | 12 |
| α-helix | 144-146 | 3 | |
| α-helix | 150-157 | 8 | |
| β-strand | 167-169 | 3 | 12 |
| α-helix | 170-173 | 4 | |
| α-helix | 185-190 | 6 | |
| α-helix | 209-212 | 4 | |
| α-helix | 224-236 | 13 | |
| α-helix | 240-242 | 3 | |
| α-helix | 252-255 | 4 | |
| α-helix | 268 | 1 | |
| β-strand | 269-272 | 4 | 15 |
| α-helix | 294-296 | 3 | |
| α-helix | 298-300 | 3 | |
| β-strand | 301 | 1 | 15 |
| α-helix | 307-309 | 3 | |
| β-strand | 312 | 1 | 16 |
| β-strand | 316 | 1 | 15 |
| β-strand | 318-320 | 3 | 17 |
| α-helix | 325-336 | 12 | |
| β-strand | 343 | 1 | 16 |
| β-strand | 354-355 | 2 | 17 |
| β-strand | 374-375 | 2 | 17 |
| β-strand | 376-379 | 4 | 15 |
| α-helix | 384-396 | 13 | |
| α-helix | 403-406 | 4 | |
| α-helix | 427-431 | 5 | |
Chain D: 16 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-4 | 2 | 18 |
| β-strand | 7-9 | 3 | 18 |
| α-helix | 11-21 | 11 | |
| β-strand | 66-68 | 3 | 18 |
| β-strand | 92 | 1 | 18 |
| α-helix | 114-121 | 8 | |
| α-helix | 123-126 | 4 | |
| β-strand | 132-138 | 7 | 18 |
| α-helix | 150-157 | 8 | |
| β-strand | 165-169 | 5 | 18 |
| β-strand | 170-172 | 3 | 19 |
| α-helix | 186-188 | 3 | |
| β-strand | 202 | 1 | 20 |
| β-strand | 203-205 | 3 | 19 |
| α-helix | 206-211 | 6 | |
| α-helix | 212-216 | 5 | |
| α-helix | 229-235 | 7 | |
| α-helix | 255-258 | 4 | |
| β-strand | 268 | 1 | 20 |
| β-strand | 269-271 | 3 | 21 |
| α-helix | 284-286 | 3 | |
| α-helix | 288-294 | 7 | |
| α-helix | 298-300 | 3 | |
| β-strand | 312-316 | 5 | 21 |
| β-strand | 319 | 1 | 22 |
| β-strand | 320 | 1 | 23 |
| α-helix | 325-332 | 8 | |
| β-strand | 352 | 1 | 21 |
| β-strand | 355 | 1 | 22 |
| β-strand | 374 | 1 | 23 |
| β-strand | 377-381 | 5 | 21 |
| α-helix | 386-389 | 4 | |
| α-helix | 395-399 | 5 | |
| α-helix | 428-436 | 9 | |
Chain E: 7 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-6 | 3 | |
| α-helix | 7-10 | 4 | |
| α-helix | 19-28 | 10 | |
| α-helix | 32-41 | 10 | |
| α-helix | 46-49 | 4 | |
| α-helix | 54-64 | 11 | |
| α-helix | 67-76 | 10 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Protein (tubulin) | A, C | protein | 451 | Bos taurus | P02550 (AlphaFold model) |
| Protein (tubulin) | B, D | protein | 445 | Bos taurus | P02554 (AlphaFold model) |
| Protein (stathmin-like domain of RB3) | E | protein | 91 | Rattus norvegicus | |
Sequence of entity 1 (A, C), FASTA
>1FFX_1 PROTEIN (TUBULIN) (chains A, C)
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY
Sequence of entity 2 (B, D), FASTA
>1FFX_2 PROTEIN (TUBULIN) (chains B, D)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEGEEDEA
Sequence of entity 3 (E), FASTA
>1FFX_3 PROTEIN (STATHMIN-LIKE DOMAIN OF RB3) (chains E)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| GDP | Guanosine-5'-diphosphate | C10 H15 N5 O11 P2 | 2 |
| GTP | Guanosine-5'-triphosphate | C10 H16 N5 O14 P3 | 2 |
Primary citation
The 4 A X-ray structure of a tubulin:stathmin-like domain complex. Gigant, B., Curmi, P.A., Martin-Barbey, C. et al. Cell (2000) 102:809-816. DOI 10.1016/S0092-8674(00)00069-6 · PubMed
Other PDB entries of the same protein (UniProt P02550 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7X4N 2.88 Å, Crystal Structure of C. elegans kinesin-4 KLP-12 complexed with tubulin and DARPin
- 9T1D 2.9 Å, Cryo-EM reconstruction of undecorated GDP microtubule
- 6MZG 3.21 Å, Structural Basis of Tubulin Recruitment and Assembly by Microtubule Polymerases with…
- 7U0F 3.53 Å, HIV-1 Rev in complex with tubulin
- 8QAU 3.54 Å, Outer kinetochore Ndc80-Dam1 alpha/beta-tubulin complex
- 8X9P 3.54 Å, HURP (428-534)-alpha-tubulin-beta-tubulin complex
- 6MZE 3.6 Å, Structural Basis of Tubulin Recruitment and Assembly by Microtubule Polymerases with…
- 6KIQ 3.62 Å, Complex of yeast cytoplasmic dynein MTBD-High and MT with DTT
- 1TUB 3.7 Å, Tubulin alpha-beta dimer, electron diffraction
- 9EDT 3.7 Å, Tubulin cofactors D,E,G bound to tubulin dimer
- 9EEB 3.7 Å, Tubulin cofactors D,E,G bound to tubulin dimer
- 9EDR 3.8 Å, Tubulin Cofactors D,E,G,C and Tubulin complex -- TBCC N Terminus Bound to Tubulin
Browse structure collections
About this viewer
MolViewer shows 1FFX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.