1TUB: Tubulin alpha-beta dimer, electron diffraction

Tubulin alpha-beta dimer, electron diffraction. Determined by electron crystallography at 3.7 Å resolution. Released 7 Oct 1998.

Method: Electron crystallography
Resolution: 3.7 Å
Organism: Sus scrofa
Chains: 2
Atoms: 6,907
Mol. weight: 98.58 kDa
Ligands: TXL, GDP, GTP
Released: 7 Oct 1998

Explore 1TUB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TUB contains 43 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	1
α-helix	11-24	14
β-strand	67-69	3	2
α-helix	72-78	7
α-helix	80-82	3
β-strand	92-94	3	2
α-helix	110-113	4
α-helix	116-125	10
β-strand	135-138	4	1
α-helix	144-146	3
α-helix	148-153	6
α-helix	155-160	6
β-strand	166-170	5	1
α-helix	183-196	14
β-strand	201-203	3	1
α-helix	206-215	10
α-helix	224-235	12
α-helix	236-241	6
α-helix	252-259	8
β-strand	269	1	3
β-strand	272	1	4
α-helix	290-296	7
β-strand	312-320	9	3
α-helix	325-335	11
β-strand	352-356	5	3
α-helix	365-367	3
β-strand	376	1	4
β-strand	377-381	5	3
α-helix	384-395	12
α-helix	396-401	6
α-helix	408-411	4
α-helix	419-434	16

Chain B: 23 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	5
α-helix	10-20	11
α-helix	21-23	3
β-strand	66-67	2	5
α-helix	73-78	6
α-helix	104-107	4
α-helix	110-127	18
β-strand	132-138	7	5
α-helix	150-160	11
β-strand	166-168	3	5
α-helix	184-194	11
β-strand	198-201	4	5
α-helix	206-211	6
α-helix	212-216	5
α-helix	224-235	12
α-helix	236-240	5
β-strand	241	1	6
β-strand	244	1	6
α-helix	252-258	7
β-strand	271-272	2	7
α-helix	280-282	3
α-helix	288-296	9
α-helix	298-300	3
β-strand	312-318	7	7
α-helix	327-336	10
α-helix	340-342	3
β-strand	343	1	7
β-strand	352-354	3	7
β-strand	376-381	6	7
α-helix	382-384	3
α-helix	385-389	5
α-helix	391-397	7
α-helix	399-403	5
α-helix	406-409	4
α-helix	419-433	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulin	A	protein	440	Sus scrofa	P02550 (AlphaFold model)
Tubulin	B	protein	427	Sus scrofa	P02554 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1TUB_1 TUBULIN (chains A)
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSV

Sequence of entity 2 (B), FASTA

>1TUB_2 TUBULIN (chains B)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQD

Ligands and cofactors

ID	Name	Formula	Copies
TXL	Taxotere	C43 H53 N O14	1
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	1

Primary citation

Structure of the alpha beta tubulin dimer by electron crystallography. Nogales, E., Wolf, S.G., Downing, K.H. Nature (1998) 391:199-203. DOI 10.1038/34465 · PubMed

Other PDB entries of the same protein (UniProt P02550 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7X4N 2.88 Å, Crystal Structure of C. elegans kinesin-4 KLP-12 complexed with tubulin and DARPin
9T1D 2.9 Å, Cryo-EM reconstruction of undecorated GDP microtubule
6MZG 3.21 Å, Structural Basis of Tubulin Recruitment and Assembly by Microtubule Polymerases with…
7U0F 3.53 Å, HIV-1 Rev in complex with tubulin
8QAU 3.54 Å, Outer kinetochore Ndc80-Dam1 alpha/beta-tubulin complex
8X9P 3.54 Å, HURP (428-534)-alpha-tubulin-beta-tubulin complex
6MZE 3.6 Å, Structural Basis of Tubulin Recruitment and Assembly by Microtubule Polymerases with…
6KIQ 3.62 Å, Complex of yeast cytoplasmic dynein MTBD-High and MT with DTT
9EDT 3.7 Å, Tubulin cofactors D,E,G bound to tubulin dimer
9EEB 3.7 Å, Tubulin cofactors D,E,G bound to tubulin dimer
9EDR 3.8 Å, Tubulin Cofactors D,E,G,C and Tubulin complex -- TBCC N Terminus Bound to Tubulin
9EDS 3.8 Å, Tubulin cofactors D,E,G,C bound to tubulin dimer -- TBCC N terminus unbound

Browse more

1TUB is part of these collections:

Motor proteins and the cytoskeleton

About this viewer

MolViewer shows 1TUB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.