1FIC: Gamma fibrinogen

Structure of human gamma fibrinogen 30 kd carboxyl terminal fragment. Determined by X-ray diffraction at 2.5 Å resolution. Released 1 Apr 1997.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,336
Mol. weight: 60.57 kDa
Ligands: CA
Released: 1 Apr 1997

Explore 1FIC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FIC contains 18 α-helices and 50 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	145-150	6	1
α-helix	153-158	6
β-strand	165-169	5	1
β-strand	178-184	7	1
β-strand	190-197	8	1
α-helix	208-213	6
β-strand	215-216	2	1
β-strand	226-227	2	1
α-helix	230-237	8
α-helix	243	1
β-strand	244-251	8	1
β-strand	257-263	7	1
β-strand	266-267	2	2
α-helix	270-272	3
β-strand	276-277	2	2
β-strand	280-283	4	1
α-helix	289-291	3
α-helix	301-305	5
α-helix	310-312	3
β-strand	313	1	3
β-strand	314	1	4
β-strand	317	1	4
α-helix	326-330	5
β-strand	334	1	3
β-strand	337	1	5
β-strand	339	1	5
β-strand	342-343	2	6
β-strand	347	1	7
β-strand	353	1	8
β-strand	366	1	7
β-strand	368-369	2	6
β-strand	377	1	8
β-strand	381-388	8	1
α-helix	389-391	3
β-strand	400-401	2	9

Chain B: 8 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	145	1	10
α-helix	153-158	6
β-strand	165-169	5	10
β-strand	178-184	7	10
β-strand	190-197	8	10
α-helix	208-213	6
β-strand	215-216	2	10
β-strand	217-218	2	9
β-strand	226-227	2	10
α-helix	230-237	8
β-strand	244-251	8	10
β-strand	257-265	9	10
β-strand	266-267	2	11
α-helix	270-272	3
β-strand	276-277	2	11
β-strand	280-283	4	10
β-strand	291	1	12
α-helix	301-304	4
β-strand	306	1	12
α-helix	310-312	3
β-strand	313	1	13
β-strand	314	1	14
β-strand	317	1	14
α-helix	326-330	5
β-strand	334	1	13
β-strand	342-343	2	15
β-strand	347	1	16
β-strand	353	1	17
α-helix	356-358	3
β-strand	366	1	16
β-strand	368-369	2	15
β-strand	377	1	17
β-strand	381-388	8	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma fibrinogen	A, B	protein	269	Homo sapiens	P02679 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1FIC_1 GAMMA FIBRINOGEN (chains A, B)
VQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSV
DFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADY
AMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKF
EGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKT
TMKIIPFNRLTIGEGQQHHLGGAKQAGDV

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Crystal structure of a 30 kDa C-terminal fragment from the gamma chain of human fibrinogen. Yee, V.C., Pratt, K.P., Cote, H.C. et al. Structure (1997) 5:125-138. DOI 10.1016/S0969-2126(97)00171-8 · PubMed

Other PDB entries of the same protein (UniProt P02679 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9KHB 1.03 Å, Crystal structure of wild-type human fibrinogen gamma chain C-terminal domain…
9KHC 1.32 Å, Crystal structure of wild-type human fibrinogen gamma chain C-terminal domain…
2Y7L 1.49 Å, Structure of N-terminal domain of Candida albicans Als9-2 in complex with human…
1DUG 1.8 Å, Structure of the fibrinogen G chain integrin binding and factor xiiia crosslinking sites…
4B60 1.83 Å, Structure of rFnBPA(189-505) in complex with fibrinogen gamma chain C- terminal peptide
2VR3 1.95 Å, Structural and Biochemical Characterization of Fibrinogen binding to ClfA from…
2FIB 2.01 Å, Recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411)…
1FIB 2.1 Å, Recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) bound…
1FID 2.1 Å, Structure of human gamma fibrinogen 30 kd carboxyl terminal fragment
3FIB 2.1 Å, Recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) bound…
1FZC 2.3 Å, Crystal structure of fragment double-D from human fibrin with two different bound ligands
3E1I 2.3 Å, Crystal Structure of BbetaD432A Variant Fibrinogen Fragment D with the Peptide Ligand…

Browse structure collections

About this viewer

MolViewer shows 1FIC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.