1FL7: Human follicle stimulating hormone

Human follicle stimulating hormone. Determined by X-ray diffraction at 3.0 Å resolution. Released 14 Mar 2001.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,187
Mol. weight: 48.44 kDa
Released: 14 Mar 2001

Explore 1FL7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FL7 contains 8 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	1
β-strand	11-14	4	1
β-strand	20	1	2
β-strand	23	1	2
β-strand	26-38	13	1
α-helix	39-40	2
α-helix	41-46	6
β-strand	53-56	4	1
β-strand	60-65	6	3
β-strand	68-70	3	4
β-strand	74-76	3	4
β-strand	79-84	6	3

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
β-strand	10-14	5	5
α-helix	15-17	3
β-strand	19-23	5	5
β-strand	26-35	10	1
β-strand	52-63	12	6
β-strand	66	1	7
β-strand	69	1	7
β-strand	72-83	12	6
β-strand	92-95	4	1

Chain C: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	8
β-strand	11-14	4	8
β-strand	20	1	9
β-strand	23	1	9
β-strand	26-38	13	8
α-helix	39-40	2
α-helix	41-45	5
β-strand	53-57	5	8
β-strand	59-69	11	10
α-helix	71-73	3
β-strand	75-85	11	10

Chain D: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4-14	11	8
α-helix	15-17	3
β-strand	19-35	17	8
α-helix	45-49	5
β-strand	50-63	14	11
β-strand	66	1	12
β-strand	69	1	12
β-strand	72-85	14	11
β-strand	92-95	4	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Follicle stimulating protein alpha chain	A, C	protein	92	Homo sapiens	P01215 (AlphaFold model)
Follicle stimulating protein beta chain	B, D	protein	111	Homo sapiens	P01225 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1FL7_1 FOLLICLE STIMULATING PROTEIN ALPHA CHAIN (chains A, C)
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Sequence of entity 2 (B, D), FASTA

>1FL7_2 FOLLICLE STIMULATING PROTEIN BETA CHAIN (chains B, D)
NSCELTNITIAIEKEECRFCISINTAWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYET
VRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Primary citation

Three-dimensional structure of human follicle-stimulating hormone. Fox, K.M., Dias, J.A., Van Roey, P. Mol Endocrinol (2001) 15:378-389. DOI 10.1210/me.15.3.378 · PubMed

Other PDB entries of the same protein (UniProt P01215 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9YXD 2.29 Å, Crystal structure of recombinant human follicle stimulating hormone in complex with an…
7UTZ 2.4 Å, Human thyrotropin analog TR1402 bound to human Thyrotropin receptor in complex with…
4AY9 2.5 Å, Structure of follicle-stimulating hormone in complex with the entire ectodomain of its…
1HCN 2.6 Å, Structure of human chorionic gonadotropin at 2.6 Å resolution from mad analysis of the…
8I2G 2.8 Å, FSHR-Follicle stimulating hormone-compound 716340-Gs complex
4MQW 2.9 Å, Structure of follicle-stimulating hormone in complex with the entire ectodomain of its…
7T9I 2.9 Å, Native human TSH bound to human Thyrotropin receptor in complex with miniGs399…
1XWD 2.92 Å, Crystal Structure of Human Follicle Stimulating Hormone Complexed with its Receptor
7XW5 2.96 Å, TSHR-thyroid stimulating hormone-Gs-ML109 complex
1HRP 3.0 Å, Crystal structure of human chorionic gonadotropin
7FIH 3.2 Å, luteinizing hormone/choriogonadotropin receptor(S277I)-chorionic…
1QFW 3.5 Å, Ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti…

Browse structure collections

About this viewer

MolViewer shows 1FL7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.