1FLR: 4-4-20 FAB fragment

4-4-20 FAB fragment. Determined by X-ray diffraction at 1.85 Å resolution. Released 15 Sept 1995.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,700
Mol. weight: 48.48 kDa
Ligands: FLU
Released: 15 Sept 1995

Explore 1FLR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FLR contains 13 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	7
β-strand	11-12	2	8
β-strand	18-22	5	7
α-helix	29-31	3
β-strand	33-39	7	9
β-strand	45-51	7	9
α-helix	54-56	3
β-strand	60-62	3	9
α-helix	64-66	3
β-strand	70-75	6	7
β-strand	80-85	6	7
α-helix	90-92	3
β-strand	94-102	9	9
β-strand	105-108	4	9
β-strand	112-114	3	9
β-strand	115-116	2	8
β-strand	122	1	10
β-strand	125-129	5	11
β-strand	142-150	9	11
β-strand	151	1	10
β-strand	156-159	4	12
α-helix	160-162	3
β-strand	168-176	9	11
β-strand	179-187	9	11
β-strand	198-204	7	12
α-helix	205-207	3
β-strand	209-215	7	12

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
β-strand	10-13	4	2
β-strand	19-24	6	1
β-strand	30	1	3
β-strand	36	1	3
β-strand	38-43	6	2
β-strand	50-54	5	2
β-strand	58-59	2	2
α-helix	60	1
β-strand	67-72	6	1
β-strand	75-80	6	1
α-helix	85-87	3
β-strand	89-95	7	2
α-helix	101	1
β-strand	102-103	2	2
β-strand	107-111	5	2
β-strand	116	1	4
β-strand	119-123	5	5
α-helix	124-126	3
α-helix	127-130	4
β-strand	134-144	11	5
β-strand	145	1	4
β-strand	150-155	6	6
β-strand	158-159	2	6
β-strand	164-168	5	5
α-helix	169-172	4
β-strand	178-187	10	5
α-helix	188-193	6
β-strand	196-202	7	6
β-strand	210-215	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4-4-20 (IG*G2A=KAPPA=) FAB fragment	L	protein	219	Mus musculus
4-4-20 (IG*G2A=KAPPA=) FAB fragment	H	protein	219	Mus musculus	P01865 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1FLR_1 4-4-20 (IG*G2A=KAPPA=) FAB FRAGMENT (chains L)
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLRWYLQKPGQSPKVLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPWTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>1FLR_2 4-4-20 (IG*G2A=KAPPA=) FAB FRAGMENT (chains H)
EVKLDETGGGLVQPGRPMKLSCVASGFTFSDYWMNWVRQSPEKGLEWVAQIRNKPYNYET
YYSDSVKGRFTISRDDSKSSVYLQMNNLRVEDMGIYYCTGSYYGMDYWGQGTSVTVSSAK
TTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLY
TLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG

Ligands and cofactors

ID	Name	Formula	Copies
FLU	2-(6-hydroxy-3-oxo-3H-xanthen-9-yl)-benzoic acid	C20 H12 O5	1

Primary citation

1.85 A structure of anti-fluorescein 4-4-20 Fab. Whitlow, M., Howard, A.J., Wood, J.F. et al. Protein Eng (1995) 8:749-761. DOI 10.1093/protein/8.8.749 · PubMed

Other PDB entries of the same protein (UniProt P01865 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NCW 1.3 Å, Cationic Cyclization Antibody 4C6 in Complex with Benzoic Acid
1RUK 1.4 Å, Crystal structure (C) of native cationic cyclization antibody 4C6 fab at pH 4.6 with a…
1RUP 1.4 Å, Crystal structure (G) of native cationic cyclization antibody 4C6 fab at pH 8.5 with a…
1RUM 1.48 Å, Crystal structure (F) of H2O2-soaked cationic cyclization antibody 4C6 fab at pH 8.5…
1RUA 1.75 Å, Crystal structure (B) of u.v.-irradiated cationic cyclization antibody 4C6 fab at pH 4.6…
1NBY 1.8 Å, Crystal Structure of HyHEL-63 complexed with HEL mutant K96A
6UQC 1.87 Å, Mouse IgG2a Bispecific Fc
1RUL 1.88 Å, Crystal Structure (D) of u.v.-irradiated cationic cyclization antibody 4C6 Fab at pH 5.6…
1NDG 1.9 Å, Crystal structure of Fab fragment of antibody HyHEL-8 complexed with its antigen lysozyme
2ADF 1.9 Å, Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody…
3FO9 1.9 Å, Crystal structure of aldolase antibody 33F12 Fab' in complex with hapten 1,3-diketone
1E4W 1.95 Å, crossreactive binding of a circularized peptide to an anti-TGFalpha antibody Fab-fragment

Browse structure collections

About this viewer

MolViewer shows 1FLR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.