Uracil DNA glycosylase with uaap. Determined by X-ray diffraction at 2.3 Å resolution. Released 17 Jan 2001.
Explore 1FLZ in 3D Show helices and sheets RCSB PDB PDBe
1FLZ contains 10 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-15 | 9 | |
| α-helix | 18-32 | 15 | |
| β-strand | 38 | 1 | 1 |
| α-helix | 46-50 | 5 | |
| β-strand | 58-62 | 5 | 2 |
| α-helix | 84-86 | 3 | |
| α-helix | 87-98 | 12 | |
| α-helix | 112-116 | 5 | |
| β-strand | 119-123 | 5 | 2 |
| β-strand | 128 | 1 | 1 |
| α-helix | 141-154 | 14 | |
| β-strand | 160-164 | 5 | 2 |
| α-helix | 166-170 | 5 | |
| β-strand | 181-185 | 5 | 2 |
| α-helix | 193-195 | 3 | |
| β-strand | 198 | 1 | 3 |
| β-strand | 200 | 1 | 3 |
| α-helix | 202-211 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Uracil-DNA glycosylase | A | protein | 228 | Escherichia coli | P12295 (AlphaFold model) |
>1FLZ_1 URACIL-DNA GLYCOSYLASE (chains A) ANELTWHDVLAEEKQQPHFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVIL GQDPYHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVLL LNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRHH VLKAPHPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDWMPVLPAESE
| ID | Name | Formula | Copies |
|---|---|---|---|
| URA | Uracil | C4 H4 N2 O2 | 1 |
Stressing-out DNA? The contribution of serine-phosphodiester interactions in catalysis by uracil DNA glycosylase. Werner, R.M., Jiang, Y.L., Gordley, R.G. et al. Biochemistry (2000) 39:12585-12594. DOI 10.1021/bi001532v · PubMed
Other PDB entries of the same protein (UniProt P12295 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1FLZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.