Crystallographic and Enzymatic Studies of an Active Site Variant H187Q of Escherichia Coli Uracil DNA Glycosylase: Crystal Structures of Mutant H187Q and its Uracil Complex. Determined by X-ray diffraction at 1.4 Å resolution. Released 23 Jul 1999.
Explore 4EUG in 3D Show helices and sheets RCSB PDB PDBe
4EUG contains 15 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-11 | 5 | |
| α-helix | 14-16 | 3 | |
| α-helix | 18-31 | 14 | |
| β-strand | 37-38 | 2 | 1 |
| α-helix | 41-43 | 3 | |
| α-helix | 46-50 | 5 | |
| α-helix | 53-55 | 3 | |
| β-strand | 58-62 | 5 | 2 |
| α-helix | 65-66 | 2 | |
| α-helix | 87-99 | 13 | |
| α-helix | 112-115 | 4 | |
| β-strand | 119-123 | 5 | 2 |
| β-strand | 128-129 | 2 | 1 |
| β-strand | 132 | 1 | 1 |
| α-helix | 141-155 | 15 | |
| β-strand | 160-164 | 5 | 2 |
| α-helix | 166-171 | 6 | |
| β-strand | 181-185 | 5 | 2 |
| α-helix | 193-195 | 3 | |
| α-helix | 202-212 | 11 | |
| α-helix | 216-218 | 3 | |
| α-helix | 224-227 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (glycosylase) | A | protein | 229 | Escherichia coli | P12295 (AlphaFold model) |
>4EUG_1 PROTEIN (GLYCOSYLASE) (chains A) MANELTWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVI LGQDPYHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVL LLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRH HVLKAPQPSPLSAHRGFFGCNHFVLANQWLEQHGETPIDWMPVLPAESE
Heteronuclear NMR and crystallographic studies of wild-type and H187Q Escherichia coli uracil DNA glycosylase: electrophilic catalysis of uracil expulsion by a neutral histidine 187. Drohat, A.C., Xiao, G., Tordova, M. et al. Biochemistry (1999) 38:11876-11886. DOI 10.1021/bi9910880 · PubMed
Other PDB entries of the same protein (UniProt P12295 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4EUG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.