1FOW: L11-C76

Name: PDB 1FOW: NMR structure of L11-C76, the C-terminal domain of 50S ribosomal protein L11, minimized average structure
Published: 1997-03-12
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosomal protein

NMR structure of L11-C76, the C-terminal domain of 50S ribosomal protein L11, minimized average structure. Determined by solution NMR. Released 12 Mar 1997.

Method: Solution NMR
Organism: Geobacillus stearothermophilus
Chains: 1
Atoms: 566
Mol. weight: 8.15 kDa
Released: 12 Mar 1997

Explore 1FOW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FOW contains 4 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	10-18	9
β-strand	34-36	3	1
α-helix	37-46	10
α-helix	48-51	4
α-helix	56-66	11
β-strand	73-75	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
L11-C76	A	protein	76	Geobacillus stearothermophilus	P56210 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FOW_1 L11-C76 (chains A)
MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAM
RMIEGTARSMGIVVED

Primary citation

High resolution solution structure of ribosomal protein L11-C76, a helical protein with a flexible loop that becomes structured upon binding to RNA. Markus, M.A., Hinck, A.P., Huang, S. et al. Nat Struct Biol (1997) 4:70-77. DOI 10.1038/nsb0197-70 · PubMed

Other PDB entries of the same protein (UniProt P56210 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HC8 2.8 Å, Crystal structure of a conserved ribosomal protein-RNA complex
1QA6 2.8 Å, Crystal structure of a conserved ribosomal protein-RNA complex
1Y39 2.8 Å, Co-evolution of protein and RNA structures within a highly conserved ribosomal domain
1C04 5.0 Å, Identification of known protein and RNA structures in a 5 a map of the large ribosomal…
1ACI L11 ribosomal protein RNA binding domain, NMR, 20 structures
1FOX NMR structure of L11-C76, the C-terminal domain of 50S ribosomal protein L11, 33…
1FOY The RNA binding domain of ribosomal protein L11: three-dimensional structure of the…
2FOW The RNA binding domain of ribosomal protein L11: three-dimensional structure of the…

Browse structure collections

About this viewer

MolViewer shows 1FOW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.