1HC8: Conserved ribosomal protein-RNA complex

Crystal structure of a conserved ribosomal protein-RNA complex. Determined by X-ray diffraction at 2.8 Å resolution. Released 23 May 2002.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: BACILLUS STEAROTHERMOPHILUS, ESCHERICHIA COLI
Chains: 4
Atoms: 3,607
Mol. weight: 55.45 kDa
Ligands: MG, OS
Released: 23 May 2002

Explore 1HC8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HC8 contains 10 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
α-helix	10-18	9
β-strand	33-35	3	1
α-helix	37-46	10
α-helix	48-50	3
α-helix	56-70	15
β-strand	72-74	3	1

Chain B: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	207-209	3
α-helix	210-218	9
β-strand	233-235	3	2
α-helix	237-247	11
α-helix	248-250	3
α-helix	256-267	12
β-strand	272-274	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosomal protein L11	A, B	protein	76	BACILLUS STEAROTHERMOPHILUS	P56210 (AlphaFold model)
58 nucleotide ribosomal 23S RNA domain	C, D	RNA	58	ESCHERICHIA COLI

Sequence of entity 1 (A, B), FASTA

>1HC8_1 RIBOSOMAL PROTEIN L11 (chains A, B)
FTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAM
RMIEGTARSMGIVVEN

Sequence of entity 2 (C, D), FASTA

>1HC8_2 58 NUCLEOTIDE RIBOSOMAL 23S RNA DOMAIN (chains C, D)
GCCAGGAUGUAGGCUUAGAAGCAGCCAUCAUUUAAAGAAAGCGUAAUAGCUCACUGGU

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	21
OS	Osmium ion	Os	4

Water and common crystallization additives (K) are not listed.

Primary citation

A Compact RNA Tertiary Structure Contains a Buried Backbone-K+ Complex. Conn, G.L., Gittis, A.G., Lattman, E.E. et al. J Mol Biol (2002) 318:963. DOI 10.1016/S0022-2836(02)00147-X · PubMed

Other PDB entries of the same protein (UniProt P56210 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QA6 2.8 Å, Crystal structure of a conserved ribosomal protein-RNA complex
1Y39 2.8 Å, Co-evolution of protein and RNA structures within a highly conserved ribosomal domain
1C04 5.0 Å, Identification of known protein and RNA structures in a 5 a map of the large ribosomal…
1ACI L11 ribosomal protein RNA binding domain, NMR, 20 structures
1FOW NMR structure of L11-C76, the C-terminal domain of 50S ribosomal protein L11, minimized…
1FOX NMR structure of L11-C76, the C-terminal domain of 50S ribosomal protein L11, 33…
1FOY The RNA binding domain of ribosomal protein L11: three-dimensional structure of the…
2FOW The RNA binding domain of ribosomal protein L11: three-dimensional structure of the…

Browse structure collections

About this viewer

MolViewer shows 1HC8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.