1G0X: Ligand binding domain of lir-1

Crystal structure of the ligand binding domain of lir-1 (ILT2). Determined by X-ray diffraction at 2.1 Å resolution. Released 17 Jan 2001.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,757
Mol. weight: 22 kDa
Released: 17 Jan 2001

Explore 1G0X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1G0X contains 8 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	15-17	3	2
β-strand	22-27	6	1
β-strand	35-39	5	3
α-helix	45-48	4
α-helix	52-55	4
β-strand	59-62	4	1
α-helix	67-69	3
β-strand	71-77	7	3
β-strand	78-79	2	4
β-strand	83-84	2	4
α-helix	85-90	6
β-strand	91-93	3	3
β-strand	94-96	3	2
α-helix	100-102	3
β-strand	103-107	5	5
β-strand	111-113	3	6
β-strand	118-123	6	5
β-strand	130-135	6	2
β-strand	143-146	4	2
α-helix	147-148	2
α-helix	149-151	3
β-strand	152-153	2	5
β-strand	156-161	6	5
β-strand	171-177	7	2
β-strand	184-185	2	2
α-helix	186-191	6
β-strand	192-193	2	2
β-strand	195-197	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucocyte immunoglobulin-like receptor-1	A	protein	197	Homo sapiens	Q8NHL6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1G0X_1 LEUCOCYTE IMMUNOGLOBULIN-LIKE RECEPTOR-1 (chains A)
HLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFP
IPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQ
CDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNS
PYEWSLPSDLLELLVLG

Primary citation

Crystal structure and ligand binding properties of the D1D2 region of the inhibitory receptor LIR-1 (ILT2). Chapman, T.L., Heikema, A.P., West Jr., A.P. et al. Immunity (2000) 13:727-736. DOI 10.1016/S1074-7613(00)00071-6 · PubMed

Other PDB entries of the same protein (UniProt Q8NHL6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UGN 1.8 Å, Crystal structure of LIR1.02, one of the alleles of LIR1
3D2U 2.21 Å, Structure of UL18, a Peptide-Binding Viral MHC Mimic, Bound to a Host Inhibitory Receptor
6EWO 2.3 Å, Crystal structure of non-phosphorylated form of RTF PHOSPHOPEPTIDE BOUND TO HLA-A2 in…
6EWA 2.39 Å, Crystal structure of HLA-A2 in complex with LILRB1
7KFK 2.63 Å, Crystal structure of LILRB1 D3D4 domain in complex with Plasmodium RIFIN (PF3D7_1373400)…
4LL9 2.69 Å, Crystal structure of D3D4 domain of the LILRB1 molecule
4NO0 2.7 Å, Crystal structure of non-phosphorylated form of RQA_V phosphopeptide bound to HLA-A2 in…
1VDG 2.8 Å, Crystal structure of LIR1.01, one of the alleles of LIR1
1UFU 3.0 Å, Crystal structure of ligand binding domain of immunoglobulin-like transcript 2 (ILT2;…
6ZDX 3.0 Å, RIFIN variable region bound to LILRB1 ectodomain
6K60 3.15 Å, Structural and functional basis for HLA-G isoform recognition of immune checkpoint…
6EWC 3.2 Å, Crystal structure of non-phosphorylated form of RLS PHOSPHOPEPTIDE BOUND TO HLA-A2 in…

Browse structure collections

About this viewer

MolViewer shows 1G0X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.