1G3J: XTCF3-cbd/beta-catenin armadillo repeat complex

Crystal structure of the XTCF3-cbd/beta-catenin armadillo repeat complex. Determined by X-ray diffraction at 2.1 Å resolution. Released 11 Dec 2000.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Homo sapiens, Xenopus laevis
Chains: 4
Atoms: 7,794
Mol. weight: 128.99 kDa
Released: 11 Dec 2000

Explore 1G3J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1G3J contains 77 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 40 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	135-147	13
α-helix	148-152	5
α-helix	153-160	8
α-helix	165-179	15
α-helix	182-189	8
α-helix	192-204	13
α-helix	208-221	14
α-helix	225-233	9
α-helix	236-242	7
α-helix	243-245	3
α-helix	249-265	17
α-helix	269-275	7
α-helix	278-284	7
α-helix	285-287	3
α-helix	291-305	15
α-helix	309-317	9
α-helix	320-328	9
α-helix	334-347	14
α-helix	353-359	7
α-helix	362-367	6
α-helix	375-389	15
α-helix	399-408	10
α-helix	414-428	15
α-helix	432-440	9
α-helix	443-454	12
α-helix	458-471	14
α-helix	478-487	10
α-helix	491-496	6
α-helix	504-517	14
α-helix	521-523	3
α-helix	524-529	6
α-helix	532-545	14
β-strand	561	1	1
β-strand	564	1	1
α-helix	566-580	15
α-helix	584-592	9
α-helix	596-601	6
α-helix	602-604	3
α-helix	608-621	14
α-helix	625-633	9
α-helix	637-643	7
α-helix	649-663	15

Chains B and D: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	2
β-strand	13-14	2	2
α-helix	15-16	2
α-helix	42-49	8

Chain C: 33 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	225-233	9
α-helix	237-242	6
α-helix	249-264	16
α-helix	269-275	7
α-helix	278-284	7
α-helix	285-287	3
α-helix	291-305	15
α-helix	309-317	9
α-helix	320-330	11
α-helix	334-347	14
α-helix	353-359	7
α-helix	362-367	6
α-helix	375-388	14
α-helix	389-391	3
α-helix	399-408	10
α-helix	414-427	14
α-helix	432-440	9
α-helix	443-454	12
α-helix	458-471	14
α-helix	478-487	10
α-helix	491-496	6
α-helix	504-517	14
α-helix	521-523	3
α-helix	524-529	6
α-helix	532-553	22
β-strand	561	1	3
β-strand	564	1	3
α-helix	566-580	15
α-helix	584-592	9
α-helix	596-601	6
α-helix	602-604	3
α-helix	608-621	14
α-helix	625-633	9
α-helix	637-643	7
α-helix	649-662	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-catenin armadillo repeat region	A, C	protein	532	Homo sapiens	P35222 (AlphaFold model)
TCF3-cbd (catenin binding domain)	B, D	protein	61	Xenopus laevis	P70062 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1G3J_1 BETA-CATENIN ARMADILLO REPEAT REGION (chains A, C)
KHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSP
QMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVL
FYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESK
LIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTD
PSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNY
KNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLP
VVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTS
MGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQR
VAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSE

Sequence of entity 2 (B, D), FASTA

>1G3J_2 TCF3-CBD (CATENIN BINDING DOMAIN) (chains B, D)
MPQLNSGGGDELGANDELIRFKDEGEQEEKSPGEGSAEGDLADVKSSLVNESENHSSDSD
S

Primary citation

Crystal structure of a beta-catenin/Tcf complex. Graham, T.A., Weaver, C., Mao, F. et al. Cell (2000) 103:885-896. DOI 10.1016/S0092-8674(00)00192-6 · PubMed

Other PDB entries of the same protein (UniProt P35222 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FQN 1.65 Å, Phosphorylation of self-peptides alters Human Leukocyte Antigen Class I-restricted…
3FQR 1.7 Å, Phosphorylation of self-peptides alters Human Leukocyte Antigen Class I-restricted…
7AFW 1.81 Å, Beta-Catenin in complex with compound 6
1JDH 1.9 Å, Crystal structure of beta-catenin and htcf-4
9I8K 2.0 Å, Beta-catenin armadillo (150-663)
9I8X 2.0 Å, Beta-catenin armadillo with cyclic peptide and Compound 2
8RU3 2.0 Å, Crystal structure of beta-catenin in complex with alpha-helical peptide inhibitor
6M90 2.05 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2776 ternary complex
29KL 2.09 Å, Crystal structure of Human Catenin Beta-1 in complex with cyclic beta sheet peptide…
1T08 2.1 Å, Crystal structure of beta-catenin/ICAT helical domain/unphosphorylated APC R3
3DIW 2.1 Å, c-terminal beta-catenin bound TIP-1 structure
8RU4 2.13 Å, Crystal structure of Human Catenin Beta-1 in complex with stitched peptide inhibitor

Browse structure collections

About this viewer

MolViewer shows 1G3J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.