1G5J: Complex of bcl-xl with peptide from bad

Complex of bcl-xl with peptide from bad. Determined by solution NMR. Released 7 Feb 2001.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,626
Mol. weight: 23.09 kDa
Released: 7 Feb 2001

Explore 1G5J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1G5J contains 13 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	3-5	3
α-helix	6-24	19
α-helix	28-30	3
α-helix	46-104	19
α-helix	106-109	4
α-helix	123-135	13
α-helix	140-160	21
α-helix	165-176	12
α-helix	177-181	5
α-helix	184-189	6
α-helix	191-199	9
α-helix	201-211	11

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	304-319	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptosis regulator bcl-X	A	protein	175	Homo sapiens	Q07817 (AlphaFold model)
Bad protein	B	protein	25		Q92934 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1G5J_1 APOPTOSIS REGULATOR BCL-X (chains A)
MSMAMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDE
FELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVD
KEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERLE

Sequence of entity 2 (B), FASTA

>1G5J_2 BAD PROTEIN (chains B)
NLWAAQRYGRELRRMSDEFVDSFKK

Primary citation

Rationale for Bcl-xL/Bad peptide complex formation from structure, mutagenesis, and biophysical studies. Petros, A.M., Nettesheim, D.G., Wang, Y. et al. Protein Sci (2000) 9:2528-2534. DOI 10.1017/S096183680000331X · PubMed

Other PDB entries of the same protein (UniProt Q07817 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7JGW 1.3 Å, Crystal structure of BCL-XL in complex with COMPOUND 1620116, CRYSTAL FORM 1
3SP7 1.4 Å, Crystal Structure of Bcl-xL bound to BM903
7YAA 1.4 Å, Crystal structure analysis of cp3 bound BCLxl
7LH7 1.41 Å, Crystal structure of BCL-XL in complex with a benzothiazole-based inhibitor
9IGG 1.5 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
4QVF 1.53 Å, Crystal structure of Bcl-xL in complex with BIM BH3 domain
4A1U 1.54 Å, Crystal structure of alpha-beta-foldamer 2c in complex with Bcl-xL
6VWC 1.6 Å, Crystal structure of Bcl-xL in complex with tetrahydroisoquinoline-pyridine based…
6O0K 1.62 Å, crystal structure of BCL-2 with venetoclax
3SPF 1.7 Å, Crystal Structure of Bcl-xL bound to BM501
9I9E 1.7 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
9O14 1.73 Å, Crystal Structure of BCL-2 in complex with a stapled BAD BH3 peptide BAD SAHB 4.2

Browse structure collections

About this viewer

MolViewer shows 1G5J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.