4A1U: Alpha-beta-foldamer 2c

Crystal structure of alpha-beta-foldamer 2c in complex with Bcl-xL. Determined by X-ray diffraction at 1.54 Å resolution. Released 28 Dec 2011.

Method: X-ray diffraction
Resolution: 1.54 Å
Organisms: HOMO SAPIENS, SYNTHETIC CONSTRUCT
Chains: 2
Atoms: 1,652
Mol. weight: 20.44 kDa
Released: 28 Dec 2011

Explore 4A1U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4A1U contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	2-18	17
α-helix	26-104	23
α-helix	108-111	4
α-helix	119-130	12
α-helix	137-156	20
α-helix	160-162	3
α-helix	163-173	11
α-helix	174-178	5
α-helix	179-182	4
α-helix	187-195	9
α-helix	199-205	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	89-101	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2-like protein 1	A	protein	158	HOMO SAPIENS	Q07817 (AlphaFold model)
Alpha-beta-foldamer 2C	B	protein	20	SYNTHETIC CONSTRUCT	O43521 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4A1U_1 BCL-2-LIKE PROTEIN 1 (chains A)
GPLGSMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQ
LHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMA
TYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQER

Sequence of entity 2 (B), FASTA

>4A1U_2 ALPHA-BETA-FOLDAMER 2C (chains B)
XIWIAQELRRIGDEFNAYYX

Primary citation

Evaluation of Diverse Alpha/Beta-Backbone Patterns for Functional Alpha-Helix Mimicry: Analogues of the Bim Bh3 Domain. Boersma, M.D., Haase, H.S., Peterson-Kaufman, K.J. et al. J Am Chem Soc (2012) 134:315. DOI 10.1021/JA207148M · PubMed

Other PDB entries of the same protein (UniProt Q07817 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7JGW 1.3 Å, Crystal structure of BCL-XL in complex with COMPOUND 1620116, CRYSTAL FORM 1
3SP7 1.4 Å, Crystal Structure of Bcl-xL bound to BM903
7YAA 1.4 Å, Crystal structure analysis of cp3 bound BCLxl
7LH7 1.41 Å, Crystal structure of BCL-XL in complex with a benzothiazole-based inhibitor
9IGG 1.5 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
4QVF 1.53 Å, Crystal structure of Bcl-xL in complex with BIM BH3 domain
6VWC 1.6 Å, Crystal structure of Bcl-xL in complex with tetrahydroisoquinoline-pyridine based…
6O0K 1.62 Å, crystal structure of BCL-2 with venetoclax
3SPF 1.7 Å, Crystal Structure of Bcl-xL bound to BM501
9I9E 1.7 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
9O14 1.73 Å, Crystal Structure of BCL-2 in complex with a stapled BAD BH3 peptide BAD SAHB 4.2
9O16 1.73 Å, Crystal Structure of human BCL-2 (R129L) mutant in complex with a stapled BAD BH3…

Browse structure collections

About this viewer

MolViewer shows 4A1U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.