9IGG: Human Bcl-xL

Structure of human Bcl-xL in complex with small molecule inhibitor. Determined by X-ray diffraction at 1.5 Å resolution. Released 24 Jun 2026.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,532
Mol. weight: 37.25 kDa
Ligands: A1I4B
Released: 24 Jun 2026

Explore 9IGG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9IGG contains 20 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	2-20	19
α-helix	25-27	3
α-helix	42-104	23
α-helix	108-110	3
α-helix	120-127	8
α-helix	128-131	4
α-helix	137-156	20
α-helix	162-177	16
α-helix	179-184	6
α-helix	187-195	9

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	4-19	16
α-helix	25-27	3
α-helix	42-104	23
α-helix	108-110	3
α-helix	120-127	8
α-helix	128-131	4
α-helix	137-156	20
α-helix	161-177	17
α-helix	180-184	5
α-helix	188-195	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptosis regulator Bcl-2,Bcl-2-like protein 1	A, B	protein	159	Homo sapiens	P10415 (AlphaFold model), Q07817 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9IGG_1 Apoptosis regulator Bcl-2,Bcl-2-like protein 1 (chains A, B)
GSYDNREIVMKYIHYKLSQRGYEWDAGADVEENRTEAPEGTESEVVKQALREAGDEFELR
YRRAFSDLTSQLHLTPGTAYGSFATVVNELFRDGVNWGRIVAFFSFGGALCVESVNREMS
PLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSM

Ligands and cofactors

ID	Name	Formula	Copies
A1I4B	2-[3-(1,3-benzothiazol-2-ylamino)-4-methyl-6,7-dihydro-5H-pyrido[2,3-c]pyridazi…	C19 H16 N6 O2 S2	2

Primary citation

Structure-Based Discovery of Potent BCL-XL Inhibitors through Rescaffolding. Timari, M.P., Paczal, A., Herner, A. et al. J Med Chem (2026) 69:14804-14818. DOI 10.1021/acs.jmedchem.6c00865 · PubMed

Other PDB entries of the same protein (UniProt P10415 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HTS 1.25 Å, Crystal structure of Bcl2 in complex with S-10r
6GL8 1.4 Å, Crystal structure of Bcl-2 in complex with the novel orally active inhibitor S55746
6QGG 1.5 Å, Structure of human Bcl-2 in complex with analogue of ABT-737
8HTR 1.6 Å, Crystal structure of Bcl2 in complex with S-9c
6O0K 1.62 Å, crystal structure of BCL-2 with venetoclax
9I9E 1.7 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
9O14 1.73 Å, Crystal Structure of BCL-2 in complex with a stapled BAD BH3 peptide BAD SAHB 4.2
9O16 1.73 Å, Crystal Structure of human BCL-2 (R129L) mutant in complex with a stapled BAD BH3…
6O0M 1.75 Å, crystal structure of BCL-2 F104L mutation with venetoclax
5VAU 1.75 Å, Bcl-2 complex with Beclin 1 BH3 domain
8VWX 1.77 Å, Human Bcl-2 (G101V Mutant)/Bcl-xL Chimera Fused to Maltose-Binding Protein
6O0P 1.8 Å, crystal structure of BCL-2 G101A mutation with venetoclax

Browse structure collections

About this viewer

MolViewer shows 9IGG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.