1G8Q: CD81 antigen, extracellular domain

Crystal structure of human CD81 extracellular domain, A receptor for hepatitis C virus. Determined by X-ray diffraction at 1.6 Å resolution. Released 21 Feb 2001.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,550
Mol. weight: 19.83 kDa
Released: 21 Feb 2001

Explore 1G8Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1G8Q contains 11 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	116-136	21
α-helix	141-154	14
α-helix	163-165	3
α-helix	166-171	6
α-helix	181-185	5
α-helix	190-199	10

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	216-235	20
α-helix	243-254	12
α-helix	263-271	9
α-helix	279-283	5
α-helix	290-299	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD81 antigen, extracellular domain	A, B	protein	90	Homo sapiens	P60033 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1G8Q_1 CD81 ANTIGEN, EXTRACELLULAR DOMAIN (chains A, B)
FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKN
NLCPSGSNIISNLFKEDCHQKIDDLFSGKH

Primary citation

CD81 extracellular domain 3D structure: insight into the tetraspanin superfamily structural motifs. Kitadokoro, K., Bordo, D., Galli, G. et al. EMBO J (2001) 20:12-18. DOI 10.1093/emboj/20.1.12 · PubMed

Other PDB entries of the same protein (UniProt P60033 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M33 1.28 Å, Structural tuning of CD81LEL (space group P21)
3X0E 1.84 Å, Crystal structure of the ectodomain of human CD81 large extracellular loop (hCD81-LEL)
5M2C 1.96 Å, Structural tuning of CD81LEL (space group P32 1 2)
5M3T 2.02 Å, Structural tuning of CD81LEL (space group P64)
6EJM 2.15 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…
5DFW 2.33 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…
5M3D 2.38 Å, Structural tuning of CD81LEL (space group P31)
6U9S 2.4 Å, Crystal structure of human CD81 large extracellular loop in complex with 5A6 Fab
1IV5 2.6 Å, New Crystal Form of Human CD81 Large Extracellular Loop.
6EK2 2.65 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…
5DFV 2.8 Å, Crystal structure of human CD81 large extracellular loop in complex with murine FAB…
6EJG 2.82 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…

Browse structure collections

About this viewer

MolViewer shows 1G8Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.