1IV5: CD81 antigen

New Crystal Form of Human CD81 Large Extracellular Loop. Determined by X-ray diffraction at 2.6 Å resolution. Released 28 Jan 2003.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,403
Mol. weight: 19.83 kDa
Released: 28 Jan 2003

Explore 1IV5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IV5 contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	116-135	20
α-helix	142-154	13
α-helix	161-170	10
α-helix	172-174	3
α-helix	183-186	4
α-helix	190-198	9

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	216-234	19
α-helix	243-253	11
α-helix	263-271	9
α-helix	290-297	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD81 antigen	A, B	protein	90	Homo sapiens	P60033 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1IV5_1 CD81 antigen (chains A, B)
FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKN
NLCPSGSNIISNLFKEDCHQKIDDLFSGKH

Primary citation

Subunit Association and Conformational Flexibility in the Head-subdomain of Human CD81 Large Extracellular Loop. Kitadokoro, K., Ponassi, M., Galli, G. et al. Biol Chem (2002) 383:1447-1452. DOI 10.1515/BC.2002.164 · PubMed

Other PDB entries of the same protein (UniProt P60033 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M33 1.28 Å, Structural tuning of CD81LEL (space group P21)
1G8Q 1.6 Å, Crystal structure of human CD81 extracellular domain, A receptor for hepatitis C virus
3X0E 1.84 Å, Crystal structure of the ectodomain of human CD81 large extracellular loop (hCD81-LEL)
5M2C 1.96 Å, Structural tuning of CD81LEL (space group P32 1 2)
5M3T 2.02 Å, Structural tuning of CD81LEL (space group P64)
6EJM 2.15 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…
5DFW 2.33 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…
5M3D 2.38 Å, Structural tuning of CD81LEL (space group P31)
6U9S 2.4 Å, Crystal structure of human CD81 large extracellular loop in complex with 5A6 Fab
6EK2 2.65 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…
5DFV 2.8 Å, Crystal structure of human CD81 large extracellular loop in complex with murine FAB…
6EJG 2.82 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…

Browse structure collections

About this viewer

MolViewer shows 1IV5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.