3X0E: CD81 antigen

Crystal structure of the ectodomain of human CD81 large extracellular loop (hCD81-LEL). Determined by X-ray diffraction at 1.84 Å resolution. Released 1 Jul 2015.

Method: X-ray diffraction
Resolution: 1.84 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,502
Mol. weight: 20.62 kDa
Ligands: MG
Released: 1 Jul 2015

Explore 3X0E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3X0E contains 11 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	116-136	21
α-helix	141-154	14
α-helix	160-165	6
α-helix	166-171	6
α-helix	181-185	5
α-helix	190-198	9

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	116-136	21
α-helix	141-154	14
α-helix	163-171	9
α-helix	182-184	3
α-helix	190-199	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD81 antigen	A, B	protein	93	Homo sapiens	P60033 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3X0E_1 CD81 antigen (chains A, B)
SHMFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSV
LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKL

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	5

Primary citation

An intramolecular bond at cluster of differentiation 81 ectodomain is important for hepatitis C virus entry. Yang, W., Zhang, M., Chi, X. et al. FASEB J (2015) 29:4214-4226. DOI 10.1096/fj.15-272880 · PubMed

Other PDB entries of the same protein (UniProt P60033 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M33 1.28 Å, Structural tuning of CD81LEL (space group P21)
1G8Q 1.6 Å, Crystal structure of human CD81 extracellular domain, A receptor for hepatitis C virus
5M2C 1.96 Å, Structural tuning of CD81LEL (space group P32 1 2)
5M3T 2.02 Å, Structural tuning of CD81LEL (space group P64)
6EJM 2.15 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…
5DFW 2.33 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…
5M3D 2.38 Å, Structural tuning of CD81LEL (space group P31)
6U9S 2.4 Å, Crystal structure of human CD81 large extracellular loop in complex with 5A6 Fab
1IV5 2.6 Å, New Crystal Form of Human CD81 Large Extracellular Loop.
6EK2 2.65 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…
5DFV 2.8 Å, Crystal structure of human CD81 large extracellular loop in complex with murine FAB…
6EJG 2.82 Å, Crystal structure of human CD81 large extracellular loop in complex with single chain fv…

Browse structure collections

About this viewer

MolViewer shows 3X0E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.