1GAW: Ferredoxin-NADP+ reductase

Crystal structure analysis of the ferredoxin-NADP+ reductase from maize leaf. Determined by X-ray diffraction at 2.2 Å resolution. Released 7 Feb 2001.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Zea mays
Chains: 2
Atoms: 5,144
Mol. weight: 72.29 kDa
Ligands: FAD
Released: 7 Feb 2001

Explore 1GAW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GAW contains 30 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	18-20	3
β-strand	22	1	1
β-strand	32	1	2
β-strand	33	1	3
β-strand	36	1	3
β-strand	38-47	10	4
β-strand	57-63	7	4
β-strand	75-79	5	4
β-strand	83	1	5
α-helix	88	1
β-strand	89	1	5
α-helix	90-92	3
β-strand	93-97	5	4
β-strand	110-116	7	4
β-strand	119-121	3	6
β-strand	127-129	3	6
α-helix	131-137	7
β-strand	144-151	8	4
α-helix	156-157	2
β-strand	158	1	1
β-strand	164-170	7	7
α-helix	171-174	4
α-helix	175-181	7
α-helix	182-186	5
β-strand	197-204	8	7
α-helix	207-209	3
α-helix	213-222	10
β-strand	227-233	7	7
β-strand	238	1	8
β-strand	244	1	8
α-helix	247-251	5
α-helix	252-254	3
α-helix	255-262	8
β-strand	267-273	7	7
α-helix	277-289	13
α-helix	296-305	10
β-strand	309-313	5	7

Chain B: 15 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	9
β-strand	32	1	10
β-strand	33	1	11
β-strand	36	1	11
β-strand	38-47	10	12
β-strand	57-63	7	12
β-strand	75-79	5	12
β-strand	83	1	13
α-helix	88	1
β-strand	89	1	13
α-helix	90-92	3
β-strand	93-97	5	12
β-strand	110-116	7	12
β-strand	119-121	3	14
β-strand	127-129	3	14
α-helix	131-137	7
β-strand	144-151	8	12
α-helix	156-157	2
β-strand	158	1	9
β-strand	164-170	7	15
α-helix	171-174	4
α-helix	175-181	7
α-helix	182-186	5
β-strand	197-204	8	15
α-helix	207-209	3
α-helix	213-222	10
β-strand	227-233	7	15
β-strand	238	1	16
β-strand	244	1	16
α-helix	247-251	5
α-helix	252-254	3
α-helix	257-262	6
β-strand	267-273	7	15
α-helix	277-289	13
α-helix	290-292	3
α-helix	296-305	10
β-strand	309-313	5	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferredoxin-NADP+ reductase	A, B	protein	314	Zea mays	Q9SLP6 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1GAW_1 FERREDOXIN-NADP+ REDUCTASE (chains A, B)
IRAQASAVEAPATAKAKKESKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHM
VFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIY
TNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSF
LWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNA
AGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYK
KQLKRGDQWNVEVY

Ligands and cofactors

ID	Name	Formula	Copies
FAD	Flavin-adenine dinucleotide	C27 H33 N9 O15 P2	2

Primary citation

Structure of the electron transfer complex between ferredoxin and ferredoxin-NADP(+) reductase. Kurisu, G., Kusunoki, M., Katoh, E. et al. Nat Struct Biol (2001) 8:117-121. DOI 10.1038/84097 · PubMed

Other PDB entries of the same protein (UniProt Q9SLP6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GAQ 2.59 Å, Crystal structure of the complex between ferredoxin and ferredoxin-NADP+ reductase
3W5U 2.7 Å, Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase
3W5V 3.81 Å, Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase

Browse structure collections

About this viewer

MolViewer shows 1GAW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.