1GCP: Vav SH3 domain

Crystal structure of vav SH3 domain. Determined by X-ray diffraction at 2.1 Å resolution. Released 8 Aug 2001.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Mus musculus
Chains: 4
Atoms: 2,341
Mol. weight: 32.12 kDa
Released: 8 Aug 2001

Explore 1GCP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GCP contains 10 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	597-599	3	1
β-strand	603	1	2
α-helix	608-610	3
β-strand	616	1	1
β-strand	619	1	2
β-strand	624-629	6	1
β-strand	634	1	3
β-strand	636-641	6	1
β-strand	646-651	6	1
α-helix	652-654	3
β-strand	655-657	3	1

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	596-599	4	4
β-strand	603	1	5
α-helix	608-610	3
β-strand	616	1	4
β-strand	619	1	5
β-strand	624-631	8	4
β-strand	636-641	6	4
β-strand	646-651	6	4
α-helix	652-654	3
β-strand	655-657	3	4

Chain C: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	597-599	3	4
β-strand	603	1	6
α-helix	608-610	3
β-strand	616	1	4
β-strand	619	1	6
β-strand	624-631	8	4
β-strand	636-641	6	4
β-strand	646-651	6	4
α-helix	652-654	3
β-strand	655-657	3	4

Chain D: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	597-599	3	7
β-strand	601	1	3
β-strand	603	1	8
α-helix	608-609	2
α-helix	615	1
β-strand	616	1	7
α-helix	617-618	2
β-strand	619	1	8
β-strand	624-629	6	7
β-strand	636-641	6	7
β-strand	646-651	6	7
α-helix	652-654	3
β-strand	655-657	3	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vav proto-oncogene	A, B, C, D	protein	70	Mus musculus	P27870 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1GCP_1 VAV PROTO-ONCOGENE (chains A, B, C, D)
GSHMPKMEVFQEYYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWF
PCNRVHPYVH

Primary citation

Novel recognition mode between Vav and Grb2 SH3 domains. Nishida, M., Nagata, K., Hachimori, Y. et al. EMBO J (2001) 20:2995-3007. DOI 10.1093/emboj/20.12.2995 · PubMed

Other PDB entries of the same protein (UniProt P27870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GCQ 1.68 Å, Crystal structure of vav and GRB2 SH3 domains
2VRW 1.85 Å, Critical structural role for the PH and C1 domains of the Vav1 exchange factor
1F5X NMR structure of the Y174 autoinhibited dbl homology domain
1K1Z Solution structure of N-terminal SH3 domain mutant(P33G) of murine Vav
2KBT Attachment of an NMR-invisible solubility enhancement tag (INSET) using a…

Browse structure collections

About this viewer

MolViewer shows 1GCP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.