1GIG: FAB fragment of a murine IgG1, lambda antibody

Refined three-dimensional structure of the FAB fragment of a murine IgG1, lambda antibody. Determined by X-ray diffraction at 2.3 Å resolution. Released 30 Apr 1994.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,352
Mol. weight: 46.37 kDa
Released: 30 Apr 1994

Explore 1GIG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GIG contains 11 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 4 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	11-12	2	7
β-strand	18-25	8	6
β-strand	33-39	7	8
β-strand	46-51	6	8
β-strand	57-59	3	8
β-strand	67-72	6	6
β-strand	77-82	6	6
α-helix	87-89	3
β-strand	91-99	9	8
β-strand	108-112	5	8
β-strand	116-118	3	8
β-strand	119-120	2	7
α-helix	123-125	3
β-strand	126	1	9
β-strand	129-133	5	10
β-strand	144-154	11	10
β-strand	155	1	9
β-strand	160-163	4	11
β-strand	172-174	3	10
α-helix	175-177	3
β-strand	178-179	2	10
β-strand	184-193	10	10
β-strand	202-208	7	11
α-helix	209-211	3
β-strand	213-219	7	11

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	9-12	4	2
β-strand	17-24	8	1
β-strand	27	1	1
α-helix	31-33	3
β-strand	36-41	6	2
β-strand	45-51	7	2
β-strand	55-56	2	2
β-strand	64-69	6	1
β-strand	72-78	7	1
α-helix	82-84	3
β-strand	86-93	8	2
β-strand	98-100	3	2
β-strand	104-108	5	2
β-strand	114	1	3
β-strand	117-121	5	4
α-helix	122-124	3
α-helix	125-129	5
β-strand	132-142	11	4
β-strand	143	1	3
β-strand	147-153	7	5
β-strand	156-157	2	5
α-helix	158	1
β-strand	162-164	3	4
α-helix	165-167	3
β-strand	168-169	2	4
β-strand	175-184	10	4
α-helix	185-190	6
β-strand	194-200	7	5
β-strand	203-209	7	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IgG1-kappa HC19 FAB (light chain)	L	protein	210	Mus musculus
IgG1-kappa HC19 FAB (heavy chain)	H	protein	221	Mus musculus	Q99LC4 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1GIG_1 IGG1-KAPPA HC19 FAB (LIGHT CHAIN) (chains L)
QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGV
PARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLGQPKSSPSVTL
FPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSY
LTLTARAWERHSSYSCQVTHEGHTVEKSLS

Sequence of entity 2 (H), FASTA

>1GIG_2 IGG1-KAPPA HC19 FAB (HEAVY CHAIN) (chains H)
QVQLKESGPGLVAPSQSLSITCTVSGFLLISNGVHWVRQPPGKGLEWLGVIWAGGNTNYN
SALMSRVSISKDNSKSQVFLKMKSLQTDDTAMYYCARDFYDYDVFYYAMDYWGQGTSVTV
SSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQ
SDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP

Primary citation

Refined three-dimensional structure of the Fab fragment of a murine IgGl,lambda antibody. Bizebard, T., Daniels, R., Kahn, R. et al. Acta Crystallogr D Biol Crystallogr (1994) 50:768-777. DOI 10.1107/S0907444994001903 · PubMed

Other PDB entries of the same protein (UniProt Q99LC4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6C5K 1.75 Å, S25-23 Fab in complex with Chlamydiaceae LPS (Crystal form 2)
6C5I 1.89 Å, Unliganded S25-5 Fab
6C5H 1.99 Å, S25-5 Fab in complex with Chlamydiaceae-specific LPS antigen
6C5J 2.29 Å, S25-23 Fab in complex with Chlamydiaceae LPS (Crystal form 1)
3HKF 2.5 Å, Murine unglycosylated IgG Fc fragment
1JHK 2.51 Å, Crystal structure of the anti-estradiol antibody 57-2
2A1W 2.7 Å, Anti-cocaine antibody 7.5.21, crystal form I
5MP3 2.75 Å, Crystal structure of DC8E8 Fab in the complex with a 30-mer tau peptide at pH 6.5
4Q0X 2.9 Å, Crystal structure of non-neutralizing antibody in complex with Epitope II of HCV E2
1JNL 3.0 Å, Crystal Structure of Fab-Estradiol Complexes
1JNN 3.2 Å, Crystal Structure of Fab-Estradiol Complexes
1AFV 3.7 Å, HIV-1 capsid protein (P24) complex with FAB25.3

Browse structure collections

About this viewer

MolViewer shows 1GIG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.