1GIU: PDB entry 1GIU

A trichosanthin(tcs) MUTANT(E85R) complex structure with adenine. Determined by X-ray diffraction at 1.8 Å resolution. Released 3 Jun 2003.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Trichosanthes kirilowii
Chains: 1
Atoms: 2,105
Mol. weight: 27.33 kDa
Ligands: ADE
Released: 3 Jun 2003

Explore 1GIU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GIU contains 15 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
α-helix	11-24	14
β-strand	27-31	5	2
β-strand	34-37	4	2
α-helix	38	1
α-helix	43-46	4
β-strand	47-53	7	1
β-strand	59-65	7	1
β-strand	70-76	7	1
β-strand	79-82	4	1
α-helix	86-94	9
β-strand	101-104	4	1
α-helix	111-118	8
α-helix	122-124	3
β-strand	127	1	3
α-helix	129-140	12
α-helix	147-155	9
α-helix	156-160	5
α-helix	161-163	3
β-strand	164	1	4
α-helix	165-172	8
β-strand	179	1	3
α-helix	180-182	3
α-helix	183-202	20
β-strand	208-216	9	5
β-strand	222-227	6	5
α-helix	231-235	5
β-strand	237	1	4
β-strand	240	1	2
α-helix	243-245	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosome-inactivating protein alpha-trichosanthin	A	protein	247	Trichosanthes kirilowii	P09989 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GIU_1 RIBOSOME-INACTIVATING PROTEIN ALPHA-TRICHOSANTHIN (chains A)
DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETI
SVAIDVTNVYIMGYRAGDTSYFFNRASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGK
IRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFL
PSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALL
LNRNNMA

Ligands and cofactors

ID	Name	Formula	Copies
ADE	Adenine	C5 H5 N5	1

Primary citation

Substrate binding and catalysis in trichosanthin occur in different sites as revealed by the complex structures of several E85 mutants. Guo, Q., Zhou, W., Too, H.M. et al. Protein Eng (2003) 16:391-396. DOI 10.1093/protein/gzg056 · PubMed

Other PDB entries of the same protein (UniProt P09989 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MRJ 1.6 Å, Studies on crystal structures active center geometry and depurine mechanism of two…
1MRK 1.6 Å, Studies on crystal structures active center geometry and depurine mechanism of two…
1GIS 1.7 Å, A trichosanthin(tcs) MUTANT(E85Q) complex structure with…
1TCS 1.7 Å, Crystal structure of trichosanthin-NADPH complex at 1.7 Å resolution reveals active-site…
1QD2 1.86 Å, Crystal structure of the complex of trichosanthin with adenine, obtained from…
1NLI 1.93 Å, Complex of [E160A-E189A] trichosanthin and adenine
1J4G 2.0 Å, crystal structure analysis of the trichosanthin delta C7
2JDL 2.2 Å, Structure of C-terminal region of acidic P2 ribosomal protein complexed with trichosanthin
2JJR 2.3 Å, V232K, N236D-trichosanthin
2VS6 2.4 Å, K173A, R174A, K177A-trichosanthin

Browse structure collections

About this viewer

MolViewer shows 1GIU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.