1NLI: PDB entry 1NLI

Complex of [E160A-E189A] trichosanthin and adenine. Determined by X-ray diffraction at 1.93 Å resolution. Released 21 Jan 2003.

Method: X-ray diffraction
Resolution: 1.93 Å
Organism: Trichosanthes kirilowii
Chains: 1
Atoms: 2,127
Mol. weight: 27.32 kDa
Ligands: ADE
Released: 21 Jan 2003

Explore 1NLI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NLI contains 15 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
α-helix	11-23	13
β-strand	27-31	5	2
β-strand	34-35	2	2
β-strand	36	1	3
β-strand	37	1	2
α-helix	38	1
α-helix	43-46	4
β-strand	47-53	7	1
β-strand	59-65	7	1
β-strand	70-76	7	1
β-strand	79-82	4	1
α-helix	86-91	6
β-strand	101-104	4	1
α-helix	111-118	8
α-helix	122-124	3
β-strand	127	1	4
α-helix	129-140	12
α-helix	144-155	12
α-helix	156-160	5
α-helix	161-163	3
β-strand	164	1	5
α-helix	165-173	9
β-strand	179	1	4
α-helix	180-182	3
α-helix	183-190	8
α-helix	192-203	12
β-strand	208-216	9	6
β-strand	222-227	6	6
α-helix	231-234	4
β-strand	237	1	5
β-strand	240	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosome-inactivating protein alpha-trichosanthin	A	protein	248	Trichosanthes kirilowii	P09989 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NLI_1 Ribosome-inactivating protein alpha-trichosanthin (chains A)
MDVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADET
ISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAG
KIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSAAARYKFIEQQIGKRVDKTF
LPSLAIISLANSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIAL
LLNRNNMA

Ligands and cofactors

ID	Name	Formula	Copies
ADE	Adenine	C5 H5 N5	1

Primary citation

Structural basis for the interaction of [E160A-E189A]-trichosanthin with adenine. Shaw, P.C., Wong, K.B., Chan, D.S. et al. Toxicon (2003) 41:575-581. DOI 10.1016/S0041-0101(02)00387-2 · PubMed

Other PDB entries of the same protein (UniProt P09989 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MRJ 1.6 Å, Studies on crystal structures active center geometry and depurine mechanism of two…
1MRK 1.6 Å, Studies on crystal structures active center geometry and depurine mechanism of two…
1GIS 1.7 Å, A trichosanthin(tcs) MUTANT(E85Q) complex structure with…
1TCS 1.7 Å, Crystal structure of trichosanthin-NADPH complex at 1.7 Å resolution reveals active-site…
1GIU 1.8 Å, A trichosanthin(tcs) MUTANT(E85R) complex structure with adenine
1QD2 1.86 Å, Crystal structure of the complex of trichosanthin with adenine, obtained from…
1J4G 2.0 Å, crystal structure analysis of the trichosanthin delta C7
2JDL 2.2 Å, Structure of C-terminal region of acidic P2 ribosomal protein complexed with trichosanthin
2JJR 2.3 Å, V232K, N236D-trichosanthin
2VS6 2.4 Å, K173A, R174A, K177A-trichosanthin

Browse structure collections

About this viewer

MolViewer shows 1NLI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.