1GJ7: Urokinase-type plasminogen activator

Engineering inhibitors highly selective for the S1 sites of SER190 trypsin-like serine protease drug targets. Determined by X-ray diffraction at 1.5 Å resolution. Released 27 Apr 2002.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,404
Mol. weight: 31.89 kDa
Ligands: 132, CIT
Released: 27 Apr 2002

Explore 1GJ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GJ7 contains 10 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	24-26	3
β-strand	30-36	7	3
β-strand	38-48	11	3
β-strand	51-54	4	3
α-helix	56-58	3
α-helix	62-63	3
β-strand	64-68	5	3
β-strand	72	1	4
β-strand	81-90	10	3
α-helix	91	1
β-strand	95-96	2	5
β-strand	99-100	2	5
β-strand	104-109	6	3
β-strand	122	1	2
α-helix	123-125	3
α-helix	130-131	2
β-strand	135-140	6	2
β-strand	154	1	4
β-strand	156-163	8	2
α-helix	165-168	4
α-helix	173-175	3
β-strand	180-184	5	2
β-strand	189	1	1
β-strand	198-203	6	2
β-strand	206-215	10	2
β-strand	222	1	6
β-strand	224	1	6
β-strand	226-230	5	2
α-helix	231-233	3
α-helix	235-241	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Urokinase-type plasminogen activator	A	protein	23	Homo sapiens	P00749 (AlphaFold model)
Urokinase-type plasminogen activator	B	protein	253	Homo sapiens	P00749 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GJ7_1 UROKINASE-TYPE PLASMINOGEN ACTIVATOR (chains A)
KPSSPPEELKFQCGQKTLRPRFK

Sequence of entity 2 (B), FASTA

>1GJ7_2 UROKINASE-TYPE PLASMINOGEN ACTIVATOR (chains B)
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVY
LGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTI
CLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTK
MLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW
IRSHTKEENGLAL

Ligands and cofactors

ID	Name	Formula	Copies
132	6-chloro-2-(2-hydroxy-biphenyl-3-yl)-1H-indole-5-carboxamidine	C21 H17 Cl N3 O	1
CIT	Citric acid	C6 H8 O7	2

Primary citation

Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets. Katz, B.A., Sprengeler, P.A., Luong, C. et al. Chem Biol (2001) 8:1107-1121. DOI 10.1016/S1074-5521(01)00084-9 · PubMed

Other PDB entries of the same protein (UniProt P00749 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YC6 1.18 Å, The crystal structure of uPA in complex with 4-Bromobenzylamirne at pH4.6
4ZKO 1.29 Å, The crystal structure of upain-1-W3A in complex with uPA at pH7.4
4ZKN 1.36 Å, The crystal structure of upain-1-W3A in complex with uPA at pH5.5
4ZKR 1.36 Å, The crystal structure of upain-1-W3A in complex with uPA at pH9.0
6XVD 1.4 Å, Crystal structure of complex of urokinase and a upain-1 variant(W3F) in pH7.4 condition
2O8T 1.45 Å, Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator…
3MHW 1.45 Å, The complex crystal Structure of Urokianse and 2-Aminobenzothiazole
5Z1C 1.45 Å, The crystal structure of uPA in complex with 4-Iodobenzylamine at pH7.4
5WXF 1.46 Å, Crystal structure of uPA in complex with upain-2-2
4MNW 1.49 Å, Crystal structure of urokinase-type plasminogen activator (uPA) complexed with bicyclic…
4XSK 1.5 Å, Structure of PAItrap, an uPA mutant
4GLY 1.52 Å, Human urokinase-type plasminogen activator uPA in complex with the two-disulfide bridge…

Browse structure collections

About this viewer

MolViewer shows 1GJ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.