2O8T: Urokinase plasminogen activator

Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator (C122A/N145Q) in complex with Inhibitors. Determined by X-ray diffraction at 1.45 Å resolution. Released 25 Dec 2007.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,094
Mol. weight: 29.22 kDa
Released: 25 Dec 2007

Explore 2O8T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2O8T contains 9 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	24-26	3
β-strand	30-34	5	3
β-strand	40-48	9	3
β-strand	51-54	4	3
α-helix	56-58	3
α-helix	62-63	3
β-strand	65-68	4	3
β-strand	72	1	4
β-strand	81-90	10	3
β-strand	95	1	5
β-strand	100	1	5
β-strand	104-108	5	3
β-strand	122	1	2
α-helix	123-125	3
α-helix	130-131	2
β-strand	135-140	6	2
β-strand	154	1	4
β-strand	156-163	8	2
α-helix	165-168	4
α-helix	173-175	3
β-strand	180-184	5	2
β-strand	189	1	1
β-strand	198-202	5	2
β-strand	207-215	9	2
β-strand	222	1	6
β-strand	224	1	6
β-strand	226-230	5	2
α-helix	231-233	3
α-helix	235-241	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Urokinase plasminogen activator	A	protein	253	Homo sapiens	P00749 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2O8T_1 Urokinase plasminogen activator (chains A)
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVY
LGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTI
ALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTK
MLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW
IRSHTKEENGLAL

Primary citation

Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator (C122A/N145Q/S195A) in complex with Inhibitors. Zhao, G., Yuan, C., Jiang, L. et al. To be published.

Other PDB entries of the same protein (UniProt P00749 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YC6 1.18 Å, The crystal structure of uPA in complex with 4-Bromobenzylamirne at pH4.6
4ZKO 1.29 Å, The crystal structure of upain-1-W3A in complex with uPA at pH7.4
4ZKN 1.36 Å, The crystal structure of upain-1-W3A in complex with uPA at pH5.5
4ZKR 1.36 Å, The crystal structure of upain-1-W3A in complex with uPA at pH9.0
6XVD 1.4 Å, Crystal structure of complex of urokinase and a upain-1 variant(W3F) in pH7.4 condition
3MHW 1.45 Å, The complex crystal Structure of Urokianse and 2-Aminobenzothiazole
5Z1C 1.45 Å, The crystal structure of uPA in complex with 4-Iodobenzylamine at pH7.4
5WXF 1.46 Å, Crystal structure of uPA in complex with upain-2-2
4MNW 1.49 Å, Crystal structure of urokinase-type plasminogen activator (uPA) complexed with bicyclic…
1GJ7 1.5 Å, Engineering inhibitors highly selective for the S1 sites of SER190 trypsin-like serine…
4XSK 1.5 Å, Structure of PAItrap, an uPA mutant
4GLY 1.52 Å, Human urokinase-type plasminogen activator uPA in complex with the two-disulfide bridge…

Browse structure collections

About this viewer

MolViewer shows 2O8T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.