4ZKN: Upain-1-W3A

The crystal structure of upain-1-W3A in complex with uPA at pH5.5. Determined by X-ray diffraction at 1.36 Å resolution. Released 18 May 2016.

Method: X-ray diffraction
Resolution: 1.36 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 2,234
Mol. weight: 29.71 kDa
Released: 18 May 2016

Explore 4ZKN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZKN contains 10 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain U: 10 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	24-26	3
β-strand	30-36	7	3
β-strand	38-48	11	3
β-strand	51-54	4	3
α-helix	56-58	3
α-helix	62-63	3
β-strand	64-68	5	3
β-strand	72	1	4
β-strand	81-90	10	3
β-strand	95	1	5
β-strand	100	1	5
β-strand	104-109	6	3
β-strand	115	1	6
β-strand	118	1	6
β-strand	122	1	2
α-helix	123-125	3
α-helix	130-131	2
β-strand	135-140	6	2
α-helix	151-152	2
β-strand	154	1	4
β-strand	156-163	8	2
α-helix	165-168	4
α-helix	173-175	3
β-strand	180-184	5	2
β-strand	189	1	1
β-strand	198-203	6	2
β-strand	206-215	10	2
β-strand	222	1	7
β-strand	224	1	7
β-strand	226-230	5	2
α-helix	231-233	3
α-helix	235-242	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Urokinase-type plasminogen activator	U	protein	247	Homo sapiens	P00749 (AlphaFold model)
upain-1-W3A	P	protein	12	synthetic construct

Sequence of entity 1 (U), FASTA

>4ZKN_1 Urokinase-type plasminogen activator (chains U)
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVY
LGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTI
ALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTK
MLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW
IRSHTKE

Sequence of entity 2 (P), FASTA

>4ZKN_2 upain-1-W3A (chains P)
CSARGLENHRMC

Primary citation

The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4. Jiang, L., Andreasen, P.A., Huang, M. To be published.

Other PDB entries of the same protein (UniProt P00749 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YC6 1.18 Å, The crystal structure of uPA in complex with 4-Bromobenzylamirne at pH4.6
4ZKO 1.29 Å, The crystal structure of upain-1-W3A in complex with uPA at pH7.4
4ZKR 1.36 Å, The crystal structure of upain-1-W3A in complex with uPA at pH9.0
6XVD 1.4 Å, Crystal structure of complex of urokinase and a upain-1 variant(W3F) in pH7.4 condition
2O8T 1.45 Å, Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator…
3MHW 1.45 Å, The complex crystal Structure of Urokianse and 2-Aminobenzothiazole
5Z1C 1.45 Å, The crystal structure of uPA in complex with 4-Iodobenzylamine at pH7.4
5WXF 1.46 Å, Crystal structure of uPA in complex with upain-2-2
4MNW 1.49 Å, Crystal structure of urokinase-type plasminogen activator (uPA) complexed with bicyclic…
1GJ7 1.5 Å, Engineering inhibitors highly selective for the S1 sites of SER190 trypsin-like serine…
4XSK 1.5 Å, Structure of PAItrap, an uPA mutant
4GLY 1.52 Å, Human urokinase-type plasminogen activator uPA in complex with the two-disulfide bridge…

Browse structure collections

About this viewer

MolViewer shows 4ZKN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.