1GK6: Vimentin

Human vimentin coil 2B fragment linked to GCN4 leucine zipper (Z2B). Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Mar 2002.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: SACCHAROMYCES CEREVISIAE, HOMO SAPIENS
Chains: 2
Atoms: 1,064
Mol. weight: 13.85 kDa
Released: 15 Mar 2002

Explore 1GK6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GK6 contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	357-405	49

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	356-405	50

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vimentin	A, B	protein	59	SACCHAROMYCES CEREVISIAE, HOMO SAPIENS	P03069 (AlphaFold model), P08670 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1GK6_1 VIMENTIN (chains A, B)
RMKQLEDKVEELLSKNYHLENEVARLKKLVGDLLNVKMALDIEIATYRKLLEGEESRIS

Primary citation

Conserved Segments 1A and 2B of the Intermediate Filament Dimer: Their Atomic Structures and Role in Filament Assembly. Strelkov, S., Herrmann, H., Geisler, N. et al. EMBO J (2002) 21:1255. DOI 10.1093/EMBOJ/21.6.1255 · PubMed

Other PDB entries of the same protein (UniProt P03069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AZD 0.98 Å, Crystal structure of tropomyosin N-terminal fragment at 0.98A resolution
2WQ1 1.08 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating bromide
2WQ0 1.12 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride
4OWI 1.2 Å, peptide structure
2WQ3 1.22 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride and nitrate
2HY6 1.25 Å, A seven-helix coiled coil
2WPZ 1.25 Å, GCN4 leucine zipper mutant with two VxxNxxx motifs coordinating chloride
6PSA 1.3 Å, PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant)
2IPZ 1.35 Å, A Parallel Coiled-Coil Tetramer with Offset Helices
2YNY 1.35 Å, Salmonella enterica SadA 255-302 fused to GCN4 adaptors (SadAK1)
5APU 1.35 Å, Sequence IANKEDKAD inserted between GCN4 adaptors - Structure A9b black
2WQ2 1.36 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating iodide

Browse structure collections

About this viewer

MolViewer shows 1GK6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.