1GMG: Regulatory protein rop

Alanine 31 proline mutant of rop protein, monoclinic form. Determined by X-ray diffraction at 1.9 Å resolution. Released 12 Sept 2002.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: ESCHERICHIA COLI
Chains: 2
Atoms: 943
Mol. weight: 14.53 kDa
Released: 12 Sept 2002

Explore 1GMG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GMG contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-26	24
α-helix	31-54	24

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-26	23
α-helix	31-54	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulatory protein rop	A, B	protein	63	ESCHERICHIA COLI	P03051 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1GMG_1 REGULATORY PROTEIN ROP (chains A, B)
MTKQEKTALNMARFIRSQTLTLLEKLNELDPDEQADICESLHDHADELYRSCLARFGDDG
ENL

Primary citation

Structure Determination of a Small Protein Through a 23-Dimensional Molecular-Replacement Search. Glykos, N.M., Kokkinidis, M. Acta Crystallogr D Biol Crystallogr (2003) 59:709. DOI 10.1107/S0907444903002889 · PubMed

Other PDB entries of the same protein (UniProt P03051 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NKD 1.09 Å, Atomic resolution (1.07 Å) structure of the rop mutant <2AA>
1RPO 1.4 Å, Restored heptad pattern continuity does not alter the folding of a 4-alpha-helical bundle
4DO2 1.4 Å, Crystal Structure of the Rop protein mutant D30P/A31G at resolution 1.4 resolution.
2IJK 1.55 Å, Structure of a Rom protein dimer at 1.55 angstrom resolution
7KAE 1.6 Å, Rop protein variant with a buried tryptophan
1ROP 1.7 Å, Structure of the COL*E1 rop protein at 1.7 Å resolution
1B6Q 1.8 Å, Alanine 31 proline mutant of rop protein
2IJH 1.8 Å, Crystal structure analysis of ColE1 ROM mutant F14W
1GTO 1.82 Å, High resolution structure of a hyperstable helical bundle protein mutant
1F4N 1.9 Å, C2 crystal structure of ALA2ILE2-6, a version of rop with a repacked hydrophobic core…
2IJJ 1.9 Å, Crystal structure analysis of ColE1 ROM mutant F14Y
3K79 1.96 Å, C38A, C52V Cysteine-Free Variant of Rop (Rom)

Browse structure collections

About this viewer

MolViewer shows 1GMG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.