1NKD: ROP

Atomic resolution (1.07 Å) structure of the rop mutant <2AA>. Determined by X-ray diffraction at 1.09 Å resolution. Released 23 Mar 1999.

Method: X-ray diffraction
Resolution: 1.09 Å
Organism: Escherichia coli
Chains: 1
Atoms: 624
Mol. weight: 7.38 kDa
Released: 23 Mar 1999

Explore 1NKD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NKD contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	3-28	26
α-helix	30-33	4
α-helix	34-58	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ROP	A	protein	65	Escherichia coli	P03051 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NKD_1 ROP (chains A)
MTKQEKTALNMARFIRSQTLTLLEKLNELADAADEQADICESLHDHADELYRSCLARFGD
DGENL

Primary citation

Structural parameters for proteins derived from the atomic resolution (1.09 A) structure of a designed variant of the ColE1 ROP protein. Vlassi, M., Dauter, Z., Wilson, K.S. et al. Acta Crystallogr D Biol Crystallogr (1998) 54:1245-1260. DOI 10.1107/S0907444998002492 · PubMed

Other PDB entries of the same protein (UniProt P03051 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1RPO 1.4 Å, Restored heptad pattern continuity does not alter the folding of a 4-alpha-helical bundle
4DO2 1.4 Å, Crystal Structure of the Rop protein mutant D30P/A31G at resolution 1.4 resolution.
2IJK 1.55 Å, Structure of a Rom protein dimer at 1.55 angstrom resolution
7KAE 1.6 Å, Rop protein variant with a buried tryptophan
1ROP 1.7 Å, Structure of the COL*E1 rop protein at 1.7 Å resolution
1B6Q 1.8 Å, Alanine 31 proline mutant of rop protein
2IJH 1.8 Å, Crystal structure analysis of ColE1 ROM mutant F14W
1GTO 1.82 Å, High resolution structure of a hyperstable helical bundle protein mutant
1F4N 1.9 Å, C2 crystal structure of ALA2ILE2-6, a version of rop with a repacked hydrophobic core…
1GMG 1.9 Å, Alanine 31 proline mutant of rop protein, monoclinic form
2IJJ 1.9 Å, Crystal structure analysis of ColE1 ROM mutant F14Y
3K79 1.96 Å, C38A, C52V Cysteine-Free Variant of Rop (Rom)

Browse structure collections

About this viewer

MolViewer shows 1NKD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.