Complex of ribonuclease from streptomyces aureofaciens with 2'-GMP at 1.7 Å resolution. Determined by X-ray diffraction at 1.77 Å resolution. Released 31 Oct 1993.
Explore 1GMR in 3D Show helices and sheets RCSB PDB PDBe
1GMR contains 8 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-7 | 3 | 1 |
| α-helix | 8-10 | 3 | |
| α-helix | 13-23 | 11 | |
| α-helix | 35 | 1 | |
| β-strand | 36-37 | 2 | 1 |
| α-helix | 45-46 | 2 | |
| β-strand | 52-56 | 5 | 1 |
| β-strand | 69-72 | 4 | 1 |
| β-strand | 79-82 | 4 | 1 |
| β-strand | 90-93 | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-7 | 3 | 2 |
| α-helix | 8-10 | 3 | |
| α-helix | 13-23 | 11 | |
| β-strand | 35-36 | 2 | 2 |
| α-helix | 37 | 1 | |
| α-helix | 45-46 | 2 | |
| β-strand | 53-57 | 5 | 2 |
| β-strand | 68-72 | 5 | 2 |
| β-strand | 79-82 | 4 | 2 |
| β-strand | 90-93 | 4 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ribonuclease sa | A, B | protein | 96 | Streptomyces aureofaciens | P05798 (AlphaFold model) |
>1GMR_1 RIBONUCLEASE SA (chains A, B) DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITP GARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
| ID | Name | Formula | Copies |
|---|---|---|---|
| 2GP | Guanosine-2'-monophosphate | C10 H14 N5 O8 P | 2 |
Water and common crystallization additives (SO4) are not listed.
Complex of ribonuclease from Streptomyces aureofaciens with 2'-GMP at 1.7 A resolution. Sevcik, J., Hill, C.P., Dauter, Z. et al. Acta Crystallogr D Biol Crystallogr (1993) 49:257-271. DOI 10.1107/S0907444992007261 · PubMed
Other PDB entries of the same protein (UniProt P05798 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1GMR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.