1GO5: C-terminal FG-binding domain of human Tap

Structure of the C-terminal FG-binding domain of human Tap. Determined by solution NMR. Released 5 Feb 2002.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 1
Atoms: 541
Mol. weight: 7.72 kDa
Released: 5 Feb 2002

Explore 1GO5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GO5 contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	17-29	13
α-helix	35-42	8
α-helix	49-58	10
α-helix	65-68	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tip associating protein	A	protein	69	HOMO SAPIENS	Q9UBU9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GO5_1 TIP ASSOCIATING PROTEIN (chains A)
PAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKG
EIPEVAFMK

Primary citation

Structure of the C-Terminal Fg-Nucleoporin Binding Domain of Tap/Nxf1. Grant, R.P., Hurt, E., Neuhaus, D. et al. Nat Struct Biol (2002) 9:247. DOI 10.1038/NSB773 · PubMed

Other PDB entries of the same protein (UniProt Q9UBU9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OAI 1.0 Å, Complex between Tap UBA domain and FxFG nucleoporin peptide
9I8A 1.5 Å, NXT1-NXF1 complex crystallized in space group P65 2 2
1JKG 1.9 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
3RW6 2.3 Å, Structure of nuclear RNA export factor TAP bound to CTE RNA
2Z5K 2.6 Å, Complex of Transportin 1 with TAP NLS
1JN5 2.8 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
1FO1 2.9 Å, Crystal structure of the RNA-binding domain of the mRNA export factor tap
2Z5M 3.0 Å, Complex of Transportin 1 with TAP NLS, crystal form 2
3RW7 3.0 Å, Structure of N-terminal domain of nuclear RNA export factor TAP
1FT8 3.15 Å, Crystal structure of the RNA-binding domain of the mRNA export factor tap
4WYK 3.4 Å, Structure of the LRR and NTF2-like domains of NXF1 complexed with NXT1
1KOH 3.8 Å, The crystal structure and mutational analysis of a novel RNA-binding domain found in the…

Browse structure collections

About this viewer

MolViewer shows 1GO5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.