2Z5K: Complex of Transportin 1 with TAP NLS

Complex of Transportin 1 with TAP NLS. Determined by X-ray diffraction at 2.6 Å resolution. Released 23 Oct 2007.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,831
Mol. weight: 104.99 kDa
Ligands: PO4
Released: 23 Oct 2007

Explore 2Z5K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Z5K contains 67 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 67 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	9-20	12
α-helix	21-23	3
α-helix	27-38	12
α-helix	39-42	4
α-helix	46-55	10
α-helix	62-77	16
α-helix	85-96	12
α-helix	104-120	17
α-helix	129-136	8
α-helix	142-158	17
α-helix	160-164	5
β-strand	167	1	1
β-strand	169	1	1
α-helix	172-181	10
α-helix	182-184	3
α-helix	188-198	11
α-helix	199-201	3
α-helix	207-210	4
α-helix	213-223	11
α-helix	229-245	17
α-helix	251-253	3
α-helix	254-265	12
α-helix	270-285	16
α-helix	289-292	4
α-helix	294-296	3
α-helix	297-307	11
α-helix	310-311	2
α-helix	312-318	7
α-helix	375-390	16
α-helix	391-394	4
α-helix	395-406	12
α-helix	411-423	13
α-helix	433-435	3
α-helix	436-446	11
α-helix	452-463	12
α-helix	466-470	5
α-helix	478-489	12
α-helix	494-511	18
α-helix	512-518	7
α-helix	519-530	12
α-helix	536-552	17
α-helix	553-556	4
α-helix	559-575	17
α-helix	583-597	15
α-helix	598-601	4
α-helix	602-627	26
α-helix	634-636	3
α-helix	639-655	17
α-helix	656-659	4
α-helix	660-664	5
α-helix	668-675	8
α-helix	681-697	17
α-helix	699-702	4
α-helix	703-705	3
α-helix	706-714	9
α-helix	722-739	18
α-helix	740-743	4
α-helix	747-758	12
α-helix	765-781	17
α-helix	783-786	4
α-helix	787-789	3
α-helix	790-801	12
α-helix	808-823	16
α-helix	825-827	3
α-helix	829-831	3
α-helix	832-840	9
α-helix	847-864	18
α-helix	866-873	8
α-helix	878-887	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transportin-1	A	protein	890	Homo sapiens	Q92973 (AlphaFold model)
Nuclear RNA export factor 1	B	protein	30	Homo sapiens	Q9UBU9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2Z5K_1 Transportin-1 (chains A)
MEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSE
DEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASK
GELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFL
QFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALV
MLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKL
IPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRSRTVAQQHDEDGIEEEDDD
DDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWVVKESGILV
LGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKP
LMTELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLI
LYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLFPLLECLSSVATALQSG
FLPYCEPVYQRCVNLVQKTLAQAMLNNAQPDQYEAPDKDFMIVALDLLSGLAEGLGGNIE
QLVARSNILTLMYQCMQDKMPEVRQSSFALLGDLTKACFQHVKPCIADFMPILGTNLNPE
FISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVEIINRPNTPKTLLENTAITIGRLGY
VCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVA
SWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV

Sequence of entity 2 (B), FASTA

>2Z5K_2 Nuclear RNA export factor 1 (chains B)
EEDDGDVAMSDAQDGPRVRYNPYTTRPNRR

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Primary citation

Structural basis for substrate recognition and dissociation by human transportin 1. Imasaki, T., Shimizu, T., Hashimoto, H. et al. Mol Cell (2007) 28:57-67. DOI 10.1016/j.molcel.2007.08.006 · PubMed

Other PDB entries of the same protein (UniProt Q92973 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FDD 2.3 Å, Crystal structure of KAP beta2-PY-NLS
4OO6 2.7 Å, Crystal structure of human KAP-beta2 bound to the NLS of HCC1 (Hepato Cellular Carcinoma…
7CYL 2.7 Å, Crystal structure of Karyopherin-beta2 in complex with FUS PY-NLS(P525L)
5YVI 2.9 Å, Crystal structure of Karyopherin beta2 in complex with FUS(456-526)
1QBK 3.0 Å, Structure of the karyopherin BETA2-ran gppnhp nuclear transport complex
2QMR 3.0 Å, Karyopherin beta2/transportin
2Z5M 3.0 Å, Complex of Transportin 1 with TAP NLS, crystal form 2
4FQ3 3.0 Å, Crystal structure of transportin/FUS-NLS
5TQC 3.0 Å, Crystal structure of transport factor karyopherin-beta 2 in complex with the PY-NLS of…
2H4M 3.05 Å, Karyopherin Beta2/Transportin-M9NLS
4JLQ 3.05 Å, Crystal structure of human Karyopherin-beta2 bound to the PY-NLS of Saccharomyces…
5J3V 3.05 Å, Crystal structure of human Karyopherin-beta2 bound to the histone H3 tail

Browse structure collections

About this viewer

MolViewer shows 2Z5K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.